PHF22 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09299

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PHF22 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat PHF22 (NP_001007641). Peptide sequence SGNGNSATAGPTGSITSKTTSETSSSTSASLKGPTSQESQLNAMKRLQMV

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PHF22 Antibody - BSA Free

Western Blot: PHF22 Antibody [NBP3-09299]

Western Blot: PHF22 Antibody [NBP3-09299]

Western Blot: PHF22 Antibody [NBP3-09299] - Western blot analysis of PHF22 in Rat Pancreas lysates. Antibody dilution at 1.0ug/ml

Applications for PHF22 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PHF22

INTS12 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690) (Baillat et al., 2005 [PubMed 16239144]).[supplied by OMIM]

Alternate Names

Int12, integrator complex subunit 12, PHD finger protein 22INT12, PHF22, SBBI22

Gene Symbol

INTS12

Additional PHF22 Products

Product Documents for PHF22 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PHF22 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PHF22 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PHF22 Antibody - BSA Free and earn rewards!

Have you used PHF22 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies