PHIP Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-33883
Loading...
Key Product Details
Species Reactivity
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NALVPGTIQVNGHGGQPSKLVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQYAKPEDLEQNNVHPIRDEVLPSSTCNFLSETNNVKEDLLQKKNRGGRKPKRKMKTQKLDADLLVPASVKVLR
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for PHIP Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: PHIP Antibody [NBP2-33883]
Immunocytochemistry/Immunofluorescence: PHIP Antibody [NBP2-33883] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -
Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -Staining of human fallopian tube shows strong nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -
Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -
Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -Staining of human testis shows strong nuclear positivity in subset of cells in seminiferous ducts.Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -
Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -Staining of human liver shows no positivity in hepatocytes as expected.Knockdown Validated: PHIP Antibody - BSA Free [NBP2-33883] -
DCAF14 regulates monomethylation of H4K20.(A) Whole-cell lysates were extracted from U2OS cells transfected with the indicated siRNAs. Immunoblots were probed with the antibodies as shown. PCNA serves as a loading control. (B) Whole-cell lysates were extracted from siNT- and siDCAF14-transfected U2OS cells. Immunoblots were probed with the several histone methylation antibodies as shown. PCNA serves as a loading control. (C) U2OS cells were either transfected with the indicated siRNAs or treated with SET8-inhibitor UNC0379 for 4 h. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. (D) siNT- and siDCAF14-transfected U2OS or HeLa cells were subjected to immunofluorescence analysis. Cells were immunostained for H4K20me1. Mean nuclei intensity was measured by quantitative imaging using DAPI-stained nuclei. Graphs represent mean +/- SEM using at least 450 nuclei. (E) Whole-cell lysates were extracted from siNT- and siDCAF14 (5′UTR)-transfected U2OS cells that were either mock transfected or overexpressing DCAF14. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. Graph represents normalized H4K20me1 intensities to histone H4 from three biological replicates.Source data are available for this figure. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37940188), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Knockdown Validated: PHIP Antibody - BSA Free [NBP2-33883] -
DCAF14 regulates monomethylation of H4K20.(A) Whole-cell lysates were extracted from U2OS cells transfected with the indicated siRNAs. Immunoblots were probed with the antibodies as shown. PCNA serves as a loading control. (B) Whole-cell lysates were extracted from siNT- and siDCAF14-transfected U2OS cells. Immunoblots were probed with the several histone methylation antibodies as shown. PCNA serves as a loading control. (C) U2OS cells were either transfected with the indicated siRNAs or treated with SET8-inhibitor UNC0379 for 4 h. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. (D) siNT- and siDCAF14-transfected U2OS or HeLa cells were subjected to immunofluorescence analysis. Cells were immunostained for H4K20me1. Mean nuclei intensity was measured by quantitative imaging using DAPI-stained nuclei. Graphs represent mean +/- SEM using at least 450 nuclei. (E) Whole-cell lysates were extracted from siNT- and siDCAF14 (5′UTR)-transfected U2OS cells that were either mock transfected or overexpressing DCAF14. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. Graph represents normalized H4K20me1 intensities to histone H4 from three biological replicates.Source data are available for this figure. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37940188), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Knockdown Validated: PHIP Antibody - BSA Free [NBP2-33883] -
DCAF14 prevents increased turnover of SET8.(A) Whole-cell lysates were extracted from U2OS, HeLa or hTERT-RPE1 cells transfected with the indicated siRNAs. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. (B) Whole cell lysates were extracted from siNT- and siDCAF14-transfected U2OS cells to analyze changes in SET8. Graph represents normalized SET8 intensities from four biological replicates. (C) Parental U2OS, DCAF14 KO, and DCAF14 cDNA-transfected KO cells were immunostained for SET8. Mean nuclei intensity was measured by quantitative imaging using DAPI-stained nuclei. Graphs represent mean +/- SEM using at least 3,500 nuclei. (D) Representative immunofluorescence images of siNT- and siDCAF14-transfected U2OS cells stained for DAPI, EdU, and SET8 are shown with overlay images. Scale bar = 10 μm. (E) siNT- and siDCAF14-transfected U2OS cells were pulsed with EdU for 30 min before immunofluorescence analyses. Mean nuclei intensity of SET8 was measured by quantitative imaging after preselecting EdU+ and EdU− nuclei. Graphs represent mean +/- SEM using at least 250 nuclei. (F) siNT- and siDCAF14-transfected U2OS cells were pretreated with either DMSO or MG132 for 2 h and pulsed with EdU during the last 30 min of treatment. Cells were immunostained for SET8 and mean nuclei intensity was measured by quantitative imaging after preselecting EdU+ and EdU− nuclei. Graphs represent mean +/- SEM using at least 250 nuclei.Source data are available for this figure. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37940188), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Knockdown Validated: PHIP Antibody - BSA Free [NBP2-33883] -
DCAF14 regulates monomethylation of H4K20.(A) Whole-cell lysates were extracted from U2OS cells transfected with the indicated siRNAs. Immunoblots were probed with the antibodies as shown. PCNA serves as a loading control. (B) Whole-cell lysates were extracted from siNT- and siDCAF14-transfected U2OS cells. Immunoblots were probed with the several histone methylation antibodies as shown. PCNA serves as a loading control. (C) U2OS cells were either transfected with the indicated siRNAs or treated with SET8-inhibitor UNC0379 for 4 h. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. (D) siNT- and siDCAF14-transfected U2OS or HeLa cells were subjected to immunofluorescence analysis. Cells were immunostained for H4K20me1. Mean nuclei intensity was measured by quantitative imaging using DAPI-stained nuclei. Graphs represent mean +/- SEM using at least 450 nuclei. (E) Whole-cell lysates were extracted from siNT- and siDCAF14 (5′UTR)-transfected U2OS cells that were either mock transfected or overexpressing DCAF14. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. Graph represents normalized H4K20me1 intensities to histone H4 from three biological replicates.Source data are available for this figure. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37940188), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Knockdown Validated: PHIP Antibody - BSA Free [NBP2-33883] -
DCAF14 regulates monomethylation of H4K20.(A) Whole-cell lysates were extracted from U2OS cells transfected with the indicated siRNAs. Immunoblots were probed with the antibodies as shown. PCNA serves as a loading control. (B) Whole-cell lysates were extracted from siNT- and siDCAF14-transfected U2OS cells. Immunoblots were probed with the several histone methylation antibodies as shown. PCNA serves as a loading control. (C) U2OS cells were either transfected with the indicated siRNAs or treated with SET8-inhibitor UNC0379 for 4 h. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. (D) siNT- and siDCAF14-transfected U2OS or HeLa cells were subjected to immunofluorescence analysis. Cells were immunostained for H4K20me1. Mean nuclei intensity was measured by quantitative imaging using DAPI-stained nuclei. Graphs represent mean +/- SEM using at least 450 nuclei. (E) Whole-cell lysates were extracted from siNT- and siDCAF14 (5′UTR)-transfected U2OS cells that were either mock transfected or overexpressing DCAF14. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. Graph represents normalized H4K20me1 intensities to histone H4 from three biological replicates.Source data are available for this figure. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37940188), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for PHIP Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PHIP
Alternate Names
DCAF14, DDB1 and CUL4 associated factor 14, FLJ20705, FLJ45918, IRS-1 PH domain-binding protein, MGC90216, ndrp, PH-interacting protein, pleckstrin homology domain interacting protein, WD repeat-containing protein 11, WDR11
Gene Symbol
PHIP
UniProt
Additional PHIP Products
Product Documents for PHIP Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PHIP Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for PHIP Antibody - BSA Free
Customer Reviews for PHIP Antibody - BSA Free
There are currently no reviews for this product. Be the first to review PHIP Antibody - BSA Free and earn rewards!
Have you used PHIP Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...