PHIP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33883

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NALVPGTIQVNGHGGQPSKLVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQYAKPEDLEQNNVHPIRDEVLPSSTCNFLSETNNVKEDLLQKKNRGGRKPKRKMKTQKLDADLLVPASVKVLR

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PHIP Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PHIP Antibody [NBP2-33883]

Immunocytochemistry/ Immunofluorescence: PHIP Antibody [NBP2-33883]

Immunocytochemistry/Immunofluorescence: PHIP Antibody [NBP2-33883] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
PHIP Antibody

Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -

Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
PHIP Antibody

Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -

Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.
PHIP Antibody

Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -

Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -Staining of human testis shows strong nuclear positivity in subset of cells in seminiferous ducts.
PHIP Antibody

Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -

Immunohistochemistry-Paraffin: PHIP Antibody [NBP2-33883] -Staining of human liver shows no positivity in hepatocytes as expected.
PHIP Antibody - BSA Free

Knockdown Validated: PHIP Antibody - BSA Free [NBP2-33883] -

DCAF14 regulates monomethylation of H4K20.(A) Whole-cell lysates were extracted from U2OS cells transfected with the indicated siRNAs. Immunoblots were probed with the antibodies as shown. PCNA serves as a loading control. (B) Whole-cell lysates were extracted from siNT- and siDCAF14-transfected U2OS cells. Immunoblots were probed with the several histone methylation antibodies as shown. PCNA serves as a loading control. (C) U2OS cells were either transfected with the indicated siRNAs or treated with SET8-inhibitor UNC0379 for 4 h. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. (D) siNT- and siDCAF14-transfected U2OS or HeLa cells were subjected to immunofluorescence analysis. Cells were immunostained for H4K20me1. Mean nuclei intensity was measured by quantitative imaging using DAPI-stained nuclei. Graphs represent mean +/- SEM using at least 450 nuclei. (E) Whole-cell lysates were extracted from siNT- and siDCAF14 (5′UTR)-transfected U2OS cells that were either mock transfected or overexpressing DCAF14. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. Graph represents normalized H4K20me1 intensities to histone H4 from three biological replicates.Source data are available for this figure. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37940188), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
PHIP Antibody - BSA Free

Knockdown Validated: PHIP Antibody - BSA Free [NBP2-33883] -

DCAF14 regulates monomethylation of H4K20.(A) Whole-cell lysates were extracted from U2OS cells transfected with the indicated siRNAs. Immunoblots were probed with the antibodies as shown. PCNA serves as a loading control. (B) Whole-cell lysates were extracted from siNT- and siDCAF14-transfected U2OS cells. Immunoblots were probed with the several histone methylation antibodies as shown. PCNA serves as a loading control. (C) U2OS cells were either transfected with the indicated siRNAs or treated with SET8-inhibitor UNC0379 for 4 h. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. (D) siNT- and siDCAF14-transfected U2OS or HeLa cells were subjected to immunofluorescence analysis. Cells were immunostained for H4K20me1. Mean nuclei intensity was measured by quantitative imaging using DAPI-stained nuclei. Graphs represent mean +/- SEM using at least 450 nuclei. (E) Whole-cell lysates were extracted from siNT- and siDCAF14 (5′UTR)-transfected U2OS cells that were either mock transfected or overexpressing DCAF14. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. Graph represents normalized H4K20me1 intensities to histone H4 from three biological replicates.Source data are available for this figure. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37940188), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
PHIP Antibody - BSA Free

Knockdown Validated: PHIP Antibody - BSA Free [NBP2-33883] -

DCAF14 prevents increased turnover of SET8.(A) Whole-cell lysates were extracted from U2OS, HeLa or hTERT-RPE1 cells transfected with the indicated siRNAs. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. (B) Whole cell lysates were extracted from siNT- and siDCAF14-transfected U2OS cells to analyze changes in SET8. Graph represents normalized SET8 intensities from four biological replicates. (C) Parental U2OS, DCAF14 KO, and DCAF14 cDNA-transfected KO cells were immunostained for SET8. Mean nuclei intensity was measured by quantitative imaging using DAPI-stained nuclei. Graphs represent mean +/- SEM using at least 3,500 nuclei. (D) Representative immunofluorescence images of siNT- and siDCAF14-transfected U2OS cells stained for DAPI, EdU, and SET8 are shown with overlay images. Scale bar = 10 μm. (E) siNT- and siDCAF14-transfected U2OS cells were pulsed with EdU for 30 min before immunofluorescence analyses. Mean nuclei intensity of SET8 was measured by quantitative imaging after preselecting EdU+ and EdU− nuclei. Graphs represent mean +/- SEM using at least 250 nuclei. (F) siNT- and siDCAF14-transfected U2OS cells were pretreated with either DMSO or MG132 for 2 h and pulsed with EdU during the last 30 min of treatment. Cells were immunostained for SET8 and mean nuclei intensity was measured by quantitative imaging after preselecting EdU+ and EdU− nuclei. Graphs represent mean +/- SEM using at least 250 nuclei.Source data are available for this figure. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37940188), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
PHIP Antibody - BSA Free

Knockdown Validated: PHIP Antibody - BSA Free [NBP2-33883] -

DCAF14 regulates monomethylation of H4K20.(A) Whole-cell lysates were extracted from U2OS cells transfected with the indicated siRNAs. Immunoblots were probed with the antibodies as shown. PCNA serves as a loading control. (B) Whole-cell lysates were extracted from siNT- and siDCAF14-transfected U2OS cells. Immunoblots were probed with the several histone methylation antibodies as shown. PCNA serves as a loading control. (C) U2OS cells were either transfected with the indicated siRNAs or treated with SET8-inhibitor UNC0379 for 4 h. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. (D) siNT- and siDCAF14-transfected U2OS or HeLa cells were subjected to immunofluorescence analysis. Cells were immunostained for H4K20me1. Mean nuclei intensity was measured by quantitative imaging using DAPI-stained nuclei. Graphs represent mean +/- SEM using at least 450 nuclei. (E) Whole-cell lysates were extracted from siNT- and siDCAF14 (5′UTR)-transfected U2OS cells that were either mock transfected or overexpressing DCAF14. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. Graph represents normalized H4K20me1 intensities to histone H4 from three biological replicates.Source data are available for this figure. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37940188), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
PHIP Antibody - BSA Free

Knockdown Validated: PHIP Antibody - BSA Free [NBP2-33883] -

DCAF14 regulates monomethylation of H4K20.(A) Whole-cell lysates were extracted from U2OS cells transfected with the indicated siRNAs. Immunoblots were probed with the antibodies as shown. PCNA serves as a loading control. (B) Whole-cell lysates were extracted from siNT- and siDCAF14-transfected U2OS cells. Immunoblots were probed with the several histone methylation antibodies as shown. PCNA serves as a loading control. (C) U2OS cells were either transfected with the indicated siRNAs or treated with SET8-inhibitor UNC0379 for 4 h. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. (D) siNT- and siDCAF14-transfected U2OS or HeLa cells were subjected to immunofluorescence analysis. Cells were immunostained for H4K20me1. Mean nuclei intensity was measured by quantitative imaging using DAPI-stained nuclei. Graphs represent mean +/- SEM using at least 450 nuclei. (E) Whole-cell lysates were extracted from siNT- and siDCAF14 (5′UTR)-transfected U2OS cells that were either mock transfected or overexpressing DCAF14. Immunoblots were probed with the antibodies as shown. KU70 serves as a loading control. Graph represents normalized H4K20me1 intensities to histone H4 from three biological replicates.Source data are available for this figure. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37940188), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for PHIP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PHIP

PH-interacting protein (PHIP) was isolated as factor that binds to the pleckstrin homology (PH) domain of insulin receptor substrate-1 (IRS-1). PHIP was determined not to be a substrate of the insulin receptor but may instead serve to link IRS-1 to the insulin receptor. PHIP has also been implicated as a positive regulator of beta-cell mitogenesis and survival. PHIP is also known as WD-repeat-containing protein 11, WDR11, and IRS-1 PH domain-binding protein.

Alternate Names

DCAF14, DDB1 and CUL4 associated factor 14, FLJ20705, FLJ45918, IRS-1 PH domain-binding protein, MGC90216, ndrp, PH-interacting protein, pleckstrin homology domain interacting protein, WD repeat-containing protein 11, WDR11

Gene Symbol

PHIP

UniProt

Additional PHIP Products

Product Documents for PHIP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PHIP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PHIP Antibody - BSA Free

Customer Reviews for PHIP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PHIP Antibody - BSA Free and earn rewards!

Have you used PHIP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...