PHKA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83392

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PHKA1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for Anti-PHKA1 antibody is: synthetic peptide directed towards the C-terminal of Human PHKA1. Peptide sequence: KQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PHKA1 Antibody - BSA Free

Western Blot: PHKA1 Antibody [NBP2-83392]

Western Blot: PHKA1 Antibody [NBP2-83392]

Western Blot: PHKA1 Antibody [NBP2-83392] - Host: Rabbit. Target Name: KPB1. Sample Type: 293T Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for PHKA1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PHKA1

The PHKA1 gene encodes the alpha subunit of muscle phosphorylase kinase (EC 2.7.1.38), a key regulatory enzyme of glycogen metabolism. Phosphorylase kinase consists of 4 copies of an alpha-beta-gamma-delta tetramer. The alpha, beta (PHKB; MIM 172490), and gamma (PHKG1; MIM 172470 and PHKG2; MIM 172471) subunits have several isoforms; the delta subunit is calmodulin (CALM1; MIM 114180). PHKA2 (MIM 306000) encodes the alpha subunit of liver-specific phosphorylase kinase and is also located on the X chromosome.[supplied by OMIM]

Alternate Names

MGC132604, PHKA, phosphorylase b kinase regulatory subunit alpha skeletal muscle isoform, phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform, Phosphorylase kinase alpha M subunit, phosphorylase kinase, alpha 1 (muscle), phosphorylase kinase, alpha 1 (muscle), muscle glycogenosis

Gene Symbol

PHKA1

Additional PHKA1 Products

Product Documents for PHKA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PHKA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PHKA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PHKA1 Antibody - BSA Free and earn rewards!

Have you used PHKA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies