Phosphoserine phosphatase Antibody (1J5O2)

Novus Biologicals | Catalog # NBP3-33385

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1J5O2
View all Phosphoserine phosphatase Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human Phosphoserine phosphatase (NP_004568.2).

Sequence:
MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Phosphoserine phosphatase Antibody (1J5O2)

Phosphoserine phosphatase Antibody (1J5O2)

Western Blot: Phosphoserine phosphatase Antibody (1J5O2) [NBP3-33385] -

Western Blot: Phosphoserine phosphatase Antibody (1J5O2) [NBP3-33385] - Western blot analysis of various lysates, using Phosphoserine phosphatase Rabbit mAb at 1:10000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for Phosphoserine phosphatase Antibody (1J5O2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:2000 - 1:10000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Phosphoserine phosphatase

Phosphoserine phosphatase is encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine. Deficiency of this protein is thought to be linked to Williams syndrome. [provided by RefSeq]

Alternate Names

L-3-phosphoserine phosphatase, O-phosphoserine phosphohydrolase, phosphoserine phosphatase, PSPase, PSPEC 3.1.3.3

Gene Symbol

PSPH

Additional Phosphoserine phosphatase Products

Product Documents for Phosphoserine phosphatase Antibody (1J5O2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Phosphoserine phosphatase Antibody (1J5O2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Phosphoserine phosphatase Antibody (1J5O2)

There are currently no reviews for this product. Be the first to review Phosphoserine phosphatase Antibody (1J5O2) and earn rewards!

Have you used Phosphoserine phosphatase Antibody (1J5O2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies