PIAS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82304

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PIAS1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PIAS1. Peptide sequence: MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PIAS1 Antibody - BSA Free

Western Blot: PIAS1 Antibody [NBP2-82304]

Western Blot: PIAS1 Antibody [NBP2-82304]

Western Blot: PIAS1 Antibody [NBP2-82304] - WB Suggested Anti-PIAS1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Placenta

Applications for PIAS1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PIAS1

PIAS1 encodes a member of the mammalian PIAS [protein inhibitor of activated STAT-1 (signal transducer and activator of transcription-1)] family. This member contains a putative zinc-binding motif and a highly acidic region. It inhibits STAT1-mediated gene activation and the DNA binding activity, binds to Gu protein/RNA helicase II/DEAD box polypeptide 21, and interacts with androgen receptor (AR). It functions in testis as a nuclear receptor transcriptional coregulator and may have a role in AR initiation and maintenance of spermatogenesis.

Long Name

Protein Inhibitor of Activated STAT 1

Alternate Names

DDXBP1, GU/RH-II, ZMIZ3

Gene Symbol

PIAS1

Additional PIAS1 Products

Product Documents for PIAS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PIAS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIAS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PIAS1 Antibody - BSA Free and earn rewards!

Have you used PIAS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies