PIBF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56805

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (91%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PIBF1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QELMKQEMETILLRQKQLEETNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPEDQLSIPEYVSVRFYELVNPLRKEICELQVKKNILAEELSTNK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PIBF1 Antibody - BSA Free

Western Blot: PIBF1 Antibody [NBP2-56805]

Western Blot: PIBF1 Antibody [NBP2-56805]

Western Blot: PIBF1 Antibody [NBP2-56805] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: PIBF1 Antibody [NBP2-56805]

Immunocytochemistry/ Immunofluorescence: PIBF1 Antibody [NBP2-56805]

Immunocytochemistry/Immunofluorescence: PIBF1 Antibody [NBP2-56805] - Staining of human cell line U-251 MG shows localization to microtubule organizing center.

Applications for PIBF1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PIBF1

PIBF (progesterone-induced blocking factor 1) is synthesized during pregnancy in response to progesterone by progesterone receptor-positive T lymphocytes (mostly gamma-delta T cells). In the presence of PIBF, natural killer (NK) cells inhibit the release of perforin from storage granules and, therefore, fail to lyse target cells. In humans, the amount of cells that express PIBF is significantly higher in healthy pregnant women than in women at risk for premature pregnancy termination. PIBF has a predicted 89 kDa molecular mass; the full-length PIBF is associated with the nucleus, whereas secretion of shorter forms, such a 34 kDa protein is induced by activation of the cell. Research suggests that PIBF functions as a transcription factor in its full-length form, while smaller forms may act as cytokines.

Long Name

Progesterone Immunomodulatory Binding Factor 1

Alternate Names

C13orf24, chromosome 13 open reading frame 24, KIAA1008, PIBF, progesterone immunomodulatory binding factor 1, progesterone-induced blocking factor 1, progesterone-induced-blocking factor 1, RP11-505F3.1

Gene Symbol

PIBF1

Additional PIBF1 Products

Product Documents for PIBF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PIBF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PIBF1 Antibody - BSA Free

Customer Reviews for PIBF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PIBF1 Antibody - BSA Free and earn rewards!

Have you used PIBF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies