PIGF Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69261

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PIGF Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PIGF(phosphatidylinositol glycan anchor biosynthesis, class F) The peptide sequence was selected from the N terminal of PIGF. Peptide sequence MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PIGF Antibody - BSA Free

Western Blot: PIGF Antibody [NBP1-69261]

Western Blot: PIGF Antibody [NBP1-69261]

Western Blot: PIGF Antibody [NBP1-69261] - This Anti-PIGF antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: PIGF Antibody [NBP1-69261]

Immunohistochemistry: PIGF Antibody [NBP1-69261]

Immunohistochemistry: PIGF Antibody [NBP1-69261] - Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm in Human Bronchial Epithelial Tissue Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X.

Applications for PIGF Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PIGF

PIGF is a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. PIGF and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. This gene encodes a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. The encoded protein and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

GPI11 homolog, MGC32646, MGC33136, phosphatidylinositol glycan anchor biosynthesis, class F, phosphatidylinositol glycan, class F, phosphatidylinositol-glycan biosynthesis class F protein, PIG-F

Gene Symbol

PIGF

UniProt

Q07326 (Human)

Additional PIGF Products

Product Documents for PIGF Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PIGF Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIGF Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PIGF Antibody - BSA Free and earn rewards!

Have you used PIGF Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies