PIGQ Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59740

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PIGQ Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PIGQ(phosphatidylinositol glycan anchor biosynthesis, class Q) The peptide sequence was selected from the N terminal of PIGQ. Peptide sequence PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: Q.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PIGQ Antibody - BSA Free

Western Blot: PIGQ Antibody [NBP1-59740]

Western Blot: PIGQ Antibody [NBP1-59740]

Western Blot: PIGQ Antibody [NBP1-59740] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Applications for PIGQ Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PIGQ

PIGQ is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGQ is a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI).This gene is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI).

Alternate Names

c407A10.1, c407A10.1 (GPI1 (N-acetylglucosaminyl transferase component)), class Q, EC 2.4.1.198, hGPI1, MGC12693, N-acetylglucosaminyl transferase component Gpi1, N-acetylglucosamyl transferase component GPI1, phosphatidylinositol glycan anchor biosynthesis, class Q, phosphatidylinositol N-acetylglucosaminyltransferase subunit Q, Phosphatidylinositol-glycan biosynthesis class Q protein, PIG-Q

Gene Symbol

PIGQ

UniProt

B2RAU6 (Human)

Additional PIGQ Products

Product Documents for PIGQ Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PIGQ Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIGQ Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PIGQ Antibody - BSA Free and earn rewards!

Have you used PIGQ Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies