PIGT Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69642

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PIGT Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PIGT(phosphatidylinositol glycan anchor biosynthesis, class T) The peptide sequence was selected from the C terminal of PIGT. Peptide sequence LPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVAAKP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PIGT Antibody - BSA Free

Western Blot: PIGT Antibody [NBP1-69642]

Western Blot: PIGT Antibody [NBP1-69642]

Western Blot: PIGT Antibody [NBP1-69642] - This Anti-PIGT antibody was used in Western Blot of Transfected 293T tissue lysate at a concentration of 1ug/ml.
Western Blot: PIGT Antibody [NBP1-69642]

Western Blot: PIGT Antibody [NBP1-69642]

Western Blot: PIGT Antibody [NBP1-69642] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Applications for PIGT Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PIGT

PIGT is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins.This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

FLJ41596, GPI transamidase component PIG-T, GPI transamidase subunit, MGC8909, NDAP, neurotrophin-regulated neuronal development-associated protein, phosphatidyl inositol glycan class T, phosphatidylinositol glycan anchor biosynthesis, class T, phosphatidylinositol glycan, class T, Phosphatidylinositol-glycan biosynthesis class T protein

Gene Symbol

PIGT

UniProt

Q969N2 (Human)

Additional PIGT Products

Product Documents for PIGT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PIGT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIGT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PIGT Antibody - BSA Free and earn rewards!

Have you used PIGT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies