PIM3 Antibody (4A9) - Azide and BSA Free
Novus Biologicals | Catalog # H00415116-M10
Key Product Details
Species Reactivity
Applications
Label
Antibody Source
Format
Product Specifications
Immunogen
Specificity
Clonality
Host
Isotype
Scientific Data Images for PIM3 Antibody (4A9) - Azide and BSA Free
Applications for PIM3 Antibody (4A9) - Azide and BSA Free
Western Blot
Formulation, Preparation, and Storage
Purification
Formulation
Format
Preservative
Concentration
Shipping
Stability & Storage
Background: PIM3
Long Name
Alternate Names
Entrez Gene IDs
Gene Symbol
UniProt
Additional PIM3 Products
Product Documents for PIM3 Antibody (4A9) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PIM3 Antibody (4A9) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for PIM3 Antibody (4A9) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review PIM3 Antibody (4A9) - Azide and BSA Free and earn rewards!
Have you used PIM3 Antibody (4A9) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for PIM3 Antibody (4A9) - Azide and BSA Free
-
Q: Does above pim3 antibody has cross reaction with pim 1 & 2 proteins?
A: I ran an alignment on the sequence and I would not predict it to react, but we have not tested for reactivity directly so I cannot guarantee that. Based on the sequence information however, I think it is safe to assume the antibody won't detect PIM1 and PIM2. Here is the sequence: DIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGAPESCDLRLCTLDPDDVASTTSSSESL. I hope you find this information useful.