PIM3 Antibody (4A9) - Azide and BSA Free

Novus Biologicals | Catalog # H00415116-M10

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4A9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

PIM3 (NP_001001852.1, 242 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGAPESCDLRLCTLDPDDVASTTSSSESL

Specificity

PIM3 - pim-3 oncogene (4A9)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for PIM3 Antibody (4A9) - Azide and BSA Free

Sandwich ELISA: PIM3 Antibody (4A9) [H00415116-M10] - Detection limit for recombinant GST tagged PIM3 is 0.03 ng/ml as a capture antibody.

Applications for PIM3 Antibody (4A9) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PIM3

PIM3 belongs to a family of protooncogenes that encode serine/threonine protein kinases (Mikkers et al., 2004 [PubMed 15199164]).[supplied by OMIM]

Long Name

Serine/threonine-protein kinase pim-3

Alternate Names

EC 2.7.11.1, pim-3, pim-3 oncogene, serine/threonine kinase Pim-3, serine/threonine-protein kinase pim-3

Entrez Gene IDs

415116 (Human)

Gene Symbol

PIM3

Additional PIM3 Products

Product Documents for PIM3 Antibody (4A9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PIM3 Antibody (4A9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIM3 Antibody (4A9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PIM3 Antibody (4A9) - Azide and BSA Free and earn rewards!

Have you used PIM3 Antibody (4A9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for PIM3 Antibody (4A9) - Azide and BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Does above pim3 antibody has cross reaction with pim 1 & 2 proteins?

    A: I ran an alignment on the sequence and I would not predict it to react, but we have not tested for reactivity directly so I cannot guarantee that. Based on the sequence information however, I think it is safe to assume the antibody won't detect PIM1 and PIM2. Here is the sequence: DIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGAPESCDLRLCTLDPDDVASTTSSSESL. I hope you find this information useful.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...