PIN/DLC8 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-58509PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to PIN/DLC8.

Source: E. coli

Amino Acid Sequence: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58509.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-58509PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PIN

DLC8 protein bound efficiently to gephyrin in in vitro binding assays and colocalized with gephyrin during coexpression in HEK293 cells. The binding site for DLC8 was mapped to a fragment of 63 amino acids within the central linker domain of gephyrin. In hippocampal neurons, endogenous DLC8 protein was enriched at synaptic sites identified by synaptophysin and gephyrin immunostaining. Because DLC8 has been described as stoichiometric components of cytoplasmic dynein and myosin-Va complexes, results suggest that motor proteins are involved in the subcellular localization of gephyrin. DLC8 was identified as a transport molecule in the cytoplasm. DLC8 co-localizes with TRPS1 in dot-like structures in the cell nucleus. In an electrophoretic mobility shift assay it was shown that the interaction of DLC8 and TRPS1 lowers the binding of TRPS1 to the GATA consensus sequence. In addition DLC8 is able to suppress the transcriptional repression activity of TRPS1.

Long Name

Protein Inhibitor of Neuronal Nitric Oxide Synthase

Alternate Names

DLC1, DLC8, DNCL1, DNCLC1, DYNLL1, LC8a

Gene Symbol

DYNLL1

Additional PIN Products

Product Documents for PIN/DLC8 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PIN/DLC8 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for PIN/DLC8 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review PIN/DLC8 Recombinant Protein Antigen and earn rewards!

Have you used PIN/DLC8 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...