PIP5K2 gamma Antibody (3E10) - Azide and BSA Free

Novus Biologicals | Catalog # H00079837-M05

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3E10

Format

Azide and BSA Free
View all PIP5K2 gamma Primary Antibodies »

Product Specifications

Immunogen

PIP4K2C (NP_079055.2, 310 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDA

Specificity

PIP5K2C - phosphatidylinositol-4-phosphate 5-kinase, type II, gamma (3E10)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for PIP5K2 gamma Antibody (3E10) - Azide and BSA Free

Sandwich ELISA: PIP5K2 gamma Antibody (3E10) [H00079837-M05] - Detection limit for recombinant GST tagged PIP4K2C is 0.03 ng/ml as a capture antibody.

Applications for PIP5K2 gamma Antibody (3E10) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This product is useful for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PIP5K2 gamma

PIP5K2 also known as Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma, has 3 isoforms, a 421 amino acid isoform that is 47 kDa, a 373 amino-acid isoform that is 42 kDa and a 403 amino-acid isoform that is 45 kDa; mostly found in the cytosol and surrounding plasma membrane; may be important in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum. Disease research is currently being studied with relation to PIP5K2 and rheumatoid arthritis and arthritis. This protein has interactions with BTK, STK11, PIP4K2C, PIK3CG, PIK3R3, PIP5K1A, and over 40 other proteins in D-myo-inositol-5-phosphate metabolism, regulation of actin cytoskeleton, B cell Receptor signaling pathway, D-myo-inositol (1,4,5)-trisphosphate biosynthesis, superpathway of inositol phosphate compounds, inositol phosphate metabolism, and phosphatidylinositol signaling system pathways.

Alternate Names

EC 2.7.1, EC 2.7.1.149, FLJ22055, phosphatidylinositol-4-phosphate 5-kinase, type II, gamma, Phosphatidylinositol-5-phosphate 4-kinase type II gamma, phosphatidylinositol-5-phosphate 4-kinase type-2 gamma, phosphatidylinositol-5-phosphate 4-kinase, type II, gamma, PI(5)P 4-kinase type II gamma, PIP4KII-gamma, PIP5K2C

Entrez Gene IDs

79837 (Human)

Gene Symbol

PIP4K2C

UniProt

NP_079055 (Human)

Additional PIP5K2 gamma Products

Product Documents for PIP5K2 gamma Antibody (3E10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PIP5K2 gamma Antibody (3E10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIP5K2 gamma Antibody (3E10) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PIP5K2 gamma Antibody (3E10) - Azide and BSA Free and earn rewards!

Have you used PIP5K2 gamma Antibody (3E10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies