PITPNM3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34121

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PITPNM3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DLVEQIETMGKLDEHQGEGTAPCTSSILQEKQRELYRVSLRRQRFPAQGSIEIHEDSEEGCPQRSCKTHV

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PITPNM3 Antibody - BSA Free

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121]

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121]

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121]

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121]

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121] - Staining of human spleen shows distinct positivity in sinusoids.
Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121]

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121]

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121]

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121]

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121] - Staining of human spleen shows high expression.
Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121]

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121]

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121] - Staining in human spleen and pancreas tissues using anti-PITPNM3 antibody. Corresponding PITPNM3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121]

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121]

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121] - Staining of human kidney.
Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121]

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121]

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-34121] - Staining of human liver.
PITPNM3 Antibody Immunohistochemistry-Paraffin: PITPNM3 Antibody Antibody [NBP2-34121]

Immunohistochemistry-Paraffin: PITPNM3 Antibody Antibody [NBP2-34121]

Staining of human kidney, pancreas, skeletal muscle and spleen using NBP2-34121 (A) shows similar protein distribution across tissues to independent antibody NBP2-33894 (B).

Applications for PITPNM3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PITPNM3

PITPNM3 is one of a range of Investigative Grade antibodies, made against targets that have limited or no commercial antibodies available to them and for which there are no data on the expression of the protein in the range of common cell lines and tissues available to us. These antibodies are affinity purified using their peptide immunogen and are known to give low background staining in a western blot. However no additional claims are made for their ability to recognise native protein in any application. NIR1 is calcium ion binding, has phosphatidylinositol transporter activity and receptor tyrosine kinase binding.

Alternate Names

membrane-associated phosphatidylinositol transfer protein 3, MGC157740, MGC157741, NIR-1, NIR1CORD5, Phosphatidylinositol transfer protein, membrane-associated 3, PITPnm 3, PITPNM family member 3, Pyk2 N-terminal domain-interacting receptor 1, RDGBA3, retinal degeneration B alpha 3

Gene Symbol

PITPNM3

UniProt

Q9BZ71 (Human)

Additional PITPNM3 Products

Product Documents for PITPNM3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PITPNM3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PITPNM3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PITPNM3 Antibody - BSA Free and earn rewards!

Have you used PITPNM3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies