PITX3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85479

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PITX3. Peptide sequence: YEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSVNVGPLASQPVFSPPSS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PITX3 Antibody - BSA Free

Western Blot: PITX3 Antibody [NBP2-85479]

Western Blot: PITX3 Antibody [NBP2-85479]

Western Blot: PITX3 Antibody [NBP2-85479] - Host: Rabbit. Target Name: PITX3. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml
Western Blot: PITX3 Antibody [NBP2-85479]

Western Blot: PITX3 Antibody [NBP2-85479]

Western Blot: PITX3 Antibody [NBP2-85479] - WB Suggested Anti-PITX3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Liver
Western Blot: PITX3 Antibody [NBP2-85479]

Western Blot: PITX3 Antibody [NBP2-85479]

Western Blot: PITX3 Antibody [NBP2-85479] - Host: Rabbit. Target Name: PITX3. Sample Tissue: Human RPMI 8226 Whole Cell. Antibody Dilution: 1ug/ml

Applications for PITX3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PITX3

PITX3 encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family act as transcription factors. This protein is involved in lens formation during eye development. Mutations of this gene have been associated with anterior segment mesenchymal dysgenesis and congenital cataracts. [provided by RefSeq]

Alternate Names

CTPP4, Homeobox protein PITX3, MGC12766, paired-like homeodomain 3, Paired-like homeodomain transcription factor 3, pituitary homeobox 3, PTX3

Gene Symbol

PITX3

Additional PITX3 Products

Product Documents for PITX3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PITX3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PITX3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PITX3 Antibody - BSA Free and earn rewards!

Have you used PITX3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...