Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to PRKACB(protein kinase, cAMP-dependent, catalytic, beta) The peptide sequence was selected from the middle region of PRKACB. Peptide sequence NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for PKA C beta Antibody - BSA Free
Western Blot: PKA C beta Antibody [NBP1-55008]
Western Blot: PKA C beta Antibody [NBP1-55008] - Mouse primary endothelial cell lysates, 20 ug total protein per lane, 4-12% Bis-Tris gel. Antibody at 1:1000. Anti-rabbit HRP conjugated secondary antibody at 1:5000. Bands visualized with Immobilon Western Chemiluminescence HRP substrate and imaged with Syngene system. WB image submitted by a verified customer review.Western Blot: PKA C beta Antibody [NBP1-55008]
Western Blot: PKA C beta Antibody [NBP1-55008] - PKA C-beta Antibody [NBP1-55008] - Human Lung lysate.Applications for PKA C beta Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Reviewed Applications
Read 1 review rated 5 using NBP1-55008 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PKA C beta
Long Name
cAMP-dependent Protein Kinase Catalytic Subunit beta
Alternate Names
cAPKbeta, PRKACB
Gene Symbol
PRKACB
UniProt
Additional PKA C beta Products
Product Documents for PKA C beta Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PKA C beta Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for PKA C beta Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used PKA C beta Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: Adult lungSpecies: MouseVerified Customer | Posted 11/04/2019Protein content from mouse primary endothelial cells was quantified by a BCA assay. Twenty micrograms of protein were resolved on a 4-12% Bis-Tris gel and transferred to nitrocellulose membranes. Membranes were probed with primary antibody PKA C beta diluted 1:1000 in 5% BSA 2, before incubation with Anti-rabbit secondary horseradish peroxidase-conjugated antibody 1:5000. Blots were visualised with Immobilon Western Chemiluminescence HRP Substrate and imaged with Syngene chemiluminescence imaging system.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...