PKA C beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55008

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PRKACB(protein kinase, cAMP-dependent, catalytic, beta) The peptide sequence was selected from the middle region of PRKACB. Peptide sequence NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PKA C beta Antibody - BSA Free

Western Blot: PKA C beta Antibody [NBP1-55008]

Western Blot: PKA C beta Antibody [NBP1-55008]

Western Blot: PKA C beta Antibody [NBP1-55008] - Mouse primary endothelial cell lysates, 20 ug total protein per lane, 4-12% Bis-Tris gel. Antibody at 1:1000. Anti-rabbit HRP conjugated secondary antibody at 1:5000. Bands visualized with Immobilon Western Chemiluminescence HRP substrate and imaged with Syngene system. WB image submitted by a verified customer review.
Western Blot: PKA C beta Antibody [NBP1-55008]

Western Blot: PKA C beta Antibody [NBP1-55008]

Western Blot: PKA C beta Antibody [NBP1-55008] - PKA C-beta Antibody [NBP1-55008] - Human Lung lysate.

Applications for PKA C beta Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 5 using NBP1-55008 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PKA C beta

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holo

Long Name

cAMP-dependent Protein Kinase Catalytic Subunit beta

Alternate Names

cAPKbeta, PRKACB

Gene Symbol

PRKACB

UniProt

Additional PKA C beta Products

Product Documents for PKA C beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PKA C beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PKA C beta Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used PKA C beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • PKA C beta Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Adult lung
    Species: Mouse
    Verified Customer | Posted 11/04/2019
    Protein content from mouse primary endothelial cells was quantified by a BCA assay. Twenty micrograms of protein were resolved on a 4-12% Bis-Tris gel and transferred to nitrocellulose membranes. Membranes were probed with primary antibody PKA C beta diluted 1:1000 in 5% BSA 2, before incubation with Anti-rabbit secondary horseradish peroxidase-conjugated antibody 1:5000. Blots were visualised with Immobilon Western Chemiluminescence HRP Substrate and imaged with Syngene chemiluminescence imaging system.
    PKA C beta Antibody - BSA Free NBP1-55008

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...