PKDREJ Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86318

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PKDREJ Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QPVYEEPSDEVEAMTYLCRKLRTMFSFLTSQSKAKDEPEFFIDMLYGQPEKNSHRYLGLKTRNINGKKMVYL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PKDREJ Antibody - BSA Free

Immunohistochemistry-Paraffin: PKDREJ Antibody [NBP1-86318]

Immunohistochemistry-Paraffin: PKDREJ Antibody [NBP1-86318]

Immunohistochemistry-Paraffin: PKDREJ Antibody [NBP1-86318] - Staining in human testis and placenta tissues using anti-PKDREJ antibody. Corresponding PKDREJ RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PKDREJ Antibody [NBP1-86318]

Immunohistochemistry-Paraffin: PKDREJ Antibody [NBP1-86318]

Immunohistochemistry-Paraffin: PKDREJ Antibody [NBP1-86318] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: PKDREJ Antibody [NBP1-86318]

Immunohistochemistry-Paraffin: PKDREJ Antibody [NBP1-86318]

Immunohistochemistry-Paraffin: PKDREJ Antibody [NBP1-86318] - Staining of human placenta shows low expression as expected.

Applications for PKDREJ Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PKDREJ

PKDREJ encodes a member of the polycystin protein family. The encoded protein contains 11 transmembrane domains, a receptor for egg jelly (REJ) domain, a G-protein-coupled receptor proteolytic site (GPS) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. This protein may play a role in human reproduction. Alternative splice variants have been described but their biological natures have not been determined.; FUNCTION: May have a central role in fertilization. May generate a Ca(2+) transporting channel directly involved in initiating the acrosome reaction of the sperm. SUBUNIT: May form homomultimers or heteromultimers in combination with an as yet unidentified subunits. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein.; TISSUE SPECIFICITY: Exclusively expressed in testis.

Alternate Names

PKD and REJ homolog, polycystic kidney disease (polycystin) and REJ homolog (sperm receptor for egg jelly homolog, sea urchin)

Gene Symbol

PKDREJ

Additional PKDREJ Products

Product Documents for PKDREJ Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PKDREJ Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PKDREJ Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PKDREJ Antibody - BSA Free and earn rewards!

Have you used PKDREJ Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies