PLA2G2A Antibody (3X9F5)

Novus Biologicals | Catalog # NBP3-15715

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3X9F5 expressed in HEK293
View all PLA2G2A Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 65-144 of human PLA2G2A (P14555). VTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PLA2G2A Antibody (3X9F5)

Western Blot: PLA2G2A Antibody (3X9F5) [NBP3-15715]

Western Blot: PLA2G2A Antibody (3X9F5) [NBP3-15715]

Western Blot: PLA2G2A Antibody (3X9F5) [NBP3-15715] - Western blot analysis of extracts of various cell lines, using PLA2G2A antibody (NBP3-15715) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Applications for PLA2G2A Antibody (3X9F5)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PLA2G2A

The protein encoded by the Phospholipase A2 IIA gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, which contains secreted form of PLA2, an extracellular enzyme that has a low molecular mass and requires calcium ions for catalysis. It catalyzes the hydrolysis of the sn-2 fatty acid acyl ester bond of phosphoglycerides, releasing free fatty acids and lysophospholipids, and thought to participate in the regulation of the phospholipid metabolism in biomembranes. Several alternatively spliced transcript variants with different 5' UTRs have been found for this gene.

Long Name

Phospholipase A2 Group IIA

Alternate Names

Mom1, PLA2B, PLA2L, RASF-A

Gene Symbol

PLA2G2A

Additional PLA2G2A Products

Product Documents for PLA2G2A Antibody (3X9F5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PLA2G2A Antibody (3X9F5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PLA2G2A Antibody (3X9F5)

There are currently no reviews for this product. Be the first to review PLA2G2A Antibody (3X9F5) and earn rewards!

Have you used PLA2G2A Antibody (3X9F5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies