PLC-beta 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88061

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PLC-beta 3. Peptide sequence: APGVPLPSPQDLMGRILVKNKKRHRPSAGGPDSAGRKRPLEQSNSALSES The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PLC-beta 3 Antibody - BSA Free

Western Blot: PLC-beta 3 Antibody [NBP2-88061]

Western Blot: PLC-beta 3 Antibody [NBP2-88061]

Western Blot: PLC-beta 3 Antibody [NBP2-88061] - Host: Rabbit. Target Name: PLCB3. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for PLC-beta 3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PLC-beta 3

Phosphoinositide-specific phospholipase C (PLC) plays a critical role in the initiation of receptor mediated signal transduction through the generation of the two second messengers, inositol 1, 4, 5-triphosphate and diacylglycerol from phosphatidylinositol 4, 5 bisphosphate. A total of eight mammalian PLC isozymes have been described (PLC beta1, PLC beta2, PLC beta3, PLC beta4, PLC gamma1, PLC gamma2, PLC delta1 and PLC delta2) with molecular weights ranging from 85 to 150 kDa. The gamma-type enzymes are unique in that they contain SH2 and SH3 domains. Moreover, the two gamma-type enzymes, but not the beta and delta isozymes, are subject to activation by a number of protein tyrosine kinases which associate with their SH2 domains and induce their activation by phosphoryation. In contrast, activation of PLC beta1, PLC beta2 and PLC beta3 is mediated by the alpha subunits of the Gq class of heterotrimeric G proteins and by certain betagamma G protein subunits. The regulatory mechanisms for PLC delta1 and PLC delta2 are as yet not resolved.

Long Name

Phospholipase C beta 3

Alternate Names

PLCB3, PLCbeta 3

Gene Symbol

PLCB3

Additional PLC-beta 3 Products

Product Documents for PLC-beta 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PLC-beta 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PLC-beta 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PLC-beta 3 Antibody - BSA Free and earn rewards!

Have you used PLC-beta 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies