PLCXD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88063

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PLCXD1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of PLCXD1. Peptide sequence: YWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PLCXD1 Antibody - BSA Free

Western Blot: PLCXD1 Antibody [NBP2-88063]

Western Blot: PLCXD1 Antibody [NBP2-88063]

Western Blot: PLCXD1 Antibody [NBP2-88063] - WB Suggested Anti-PLCXD1 Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole CellPLCXD1 is supported by BioGPS gene expression data to be expressed in 721_B

Applications for PLCXD1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PLCXD1

Phospholipases are a group of enzymes that hydrolyze phospholipids into fatty acids and other lipophilic molecules. PLC is subdivided into beta, gamma, delta, epsilon, zeta and eta subtypes, which catalyze the hydrolysis of phosphatidylinositol 4,5-bisphosphate (PIP2) to inositol 1,4,5-trisphosphate (IP3) and 1,2-diacylglycerol (DAG). IP3 and DAG both have important second messenger functions. PLC-beta is primarily activated by Gq/11 proteins and PLC-gamma is activated by phosphorylation in response to a variety of growth factor and immune system signals. Phospholipases are ubiquitously expressed and have diverse biological functions including roles in inflammation, cell growth, signaling and death and maintenance of membrane phospholipids.

Alternate Names

FLJ11323, phosphatidylinositol-specific phospholipase C, X domain containing 1, PI-PLC X domain-containing protein 1

Gene Symbol

PLCXD1

Additional PLCXD1 Products

Product Documents for PLCXD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PLCXD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PLCXD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PLCXD1 Antibody - BSA Free and earn rewards!

Have you used PLCXD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies