PLOD3 Antibody (5R6Q9)

Novus Biologicals | Catalog # NBP3-33264

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 5R6Q9
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 25-306 of human PLOD3 (NP_001075.1).

Sequence:
SDRPRGRDPVNPEKLLVITVATAETEGYLRFLRSAEFFNYTVRTLGLGEEWRGGDVARTVGGGQKVRWLKKEMEKYADREDMIIMFVDSYDVILAGSPTELLKKFVQSGSRLLFSAESFCWPEWGLAEQYPEVGTGKRFLNSGGFIGFATTIHQIVRQWKYKDDDDDQLFYTRLYLDPGLREKLSLNLDHKSRIFQNLNGALDEVVLKFDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFLAVFVEQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

85 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PLOD3 Antibody (5R6Q9)

PLOD3 Antibody (5R6Q9)

Western Blot: PLOD3 Antibody (5R6Q9) [NBP3-33264] -

Western Blot: PLOD3 Antibody (5R6Q9) [NBP3-33264] - Western blot analysis of various lysates using PLOD3 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.
PLOD3 Antibody (5R6Q9)

Western Blot: PLOD3 Antibody (5R6Q9) [NBP3-33264] -

Western Blot: PLOD3 Antibody (5R6Q9) [NBP3-33264] - Western blot analysis of lysates from Mouse brain, using PLOD3 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for PLOD3 Antibody (5R6Q9)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PLOD3

PLOD3 is encoded by this gene is a membrane-bound homodimeric enzyme that is localized to the cisternae of the rough endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VIB have deficiencies in lysyl hydroxylase activity. [provided by RefSeq]

Alternate Names

2-oxoglutarate 5-dioxygenase 3, EC 1.14.11.4, LH3Lysyl hydroxylase 3, lysine hydroxylase 3, procollagen-lysine, procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3

Gene Symbol

PLOD3

Additional PLOD3 Products

Product Documents for PLOD3 Antibody (5R6Q9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PLOD3 Antibody (5R6Q9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PLOD3 Antibody (5R6Q9)

There are currently no reviews for this product. Be the first to review PLOD3 Antibody (5R6Q9) and earn rewards!

Have you used PLOD3 Antibody (5R6Q9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...