PMP22 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86749

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PMP22 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of PMP22. Peptide sequence: QWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PMP22 Antibody - BSA Free

Western Blot: PMP22 Antibody [NBP2-86749]

Western Blot: PMP22 Antibody [NBP2-86749]

Western Blot: PMP22 Antibody [NBP2-86749] - WB Suggested Anti-PMP22 Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole Cell

Applications for PMP22 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PMP22

Peripheral Myelin Protein 22 (PMP22) is a 160 amino acid glycoprotein which is a member of the claudin family and is thought to play an important role in the structure of peripheral nerve myelin. Irregularities in its gene results in hereditary demyelinating neuropathies. PMP22 protein is present in the compact myelin of adult human peripheral nerve and its distribution mimics that of Myelin Protein zero (P0).

Alternate Names

CMT1A, CMT1E, GAS3, GAS-3DSS, growth arrest-specific 3, Growth arrest-specific protein 3, HMSNIA, HNPP, MGC20769, peripheral myelin protein 22, PMP-22, Sp110

Gene Symbol

PMP22

Additional PMP22 Products

Product Documents for PMP22 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PMP22 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PMP22 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PMP22 Antibody - BSA Free and earn rewards!

Have you used PMP22 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies