PNMA2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85508

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PNMA2. Peptide sequence: ELKDQGPPPSFLELMKVIREEEEEEASFENESIEEPEERDGYGRWNHEGD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PNMA2 Antibody - BSA Free

Western Blot: PNMA2 Antibody [NBP2-85508]

Western Blot: PNMA2 Antibody [NBP2-85508]

Western Blot: PNMA2 Antibody [NBP2-85508] - WB Suggested Anti-PNMA2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysate

Applications for PNMA2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PNMA2

In patients with cancer, symptoms of limbic and brain-stem dysfunction may result from a para-neoplastic disorder. Two proteins, Ma1 and Ma2, were discovered by presence of autoantibodies against them. Antibodies to Ma1 and Ma2 proteins identify a paraneoplastic disorder that affects the limbic system, brain stem, and cerebellum. These autoantibodies were used to clone Ma2, which codes for a protein (Ma2) that was recognized by serum from the 10 patients, but not by serum from 344 control subjects. Ma2 was selectively expressed by normal brain tissue and by the testicular tumors of the patients. Ma2 shares homology with Ma1, a "brain-testis-cancer" gene related to other para-neoplastic syndromes and tumors.

Alternate Names

MA2KIAA0883, MM2, Onconeuronal antigen Ma2, paraneoplastic antigen MA2,40 kDa neuronal protein, Paraneoplastic neuronal antigen MM2, retrotransposon gag domain containing 2, RGAG2

Gene Symbol

PNMA2

Additional PNMA2 Products

Product Documents for PNMA2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PNMA2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PNMA2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PNMA2 Antibody - BSA Free and earn rewards!

Have you used PNMA2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...