POGZ Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10961

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POGZ (NP_665739). Peptide sequence STMPVRPTTNTFTTVIPATLTIRSTVPQSQSQQTKSTPSTSTTPTATQPT

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for POGZ Antibody - BSA Free

Western Blot: POGZ Antibody [NBP3-10961]

Western Blot: POGZ Antibody [NBP3-10961]

Western Blot: POGZ Antibody [NBP3-10961] - Western blot analysis using NBP3-10961 on Human HepG2 as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for POGZ Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POGZ

Pogz is a zinc-finger protein containing at least 8 C2H2 zinc fingers, a CENP-B (centromere protein-B) domain, and a DDE domain found in the bacterial transposase/retroviral integrase family. Members of this family of integrases share structural homologies and show similar catalytic activity to the RAG1 and RAG2 proteins that initiate V(D)J recombination in lymphoid progenitors. Mouse Pogz has a human homolog with a base pair similarity of 90% and amino acid similarity of 93% for the full length protein. In humans at least 3 variants have been predicted and they are all similar at the Nterminus. A number of expressed sequence tags (ESTs) cloned from murine undifferentiated ES cells and Lin-/c-Kit+/Sca-1+ hematopoietic stem cell cDNA libraries correspond to the Pogz gene, further underlining an important function for this gene in stem cells. In mice, deletion of the gene in all tissues early in embryogenesis has been shown to be lethal.

Alternate Names

KIAA0461ZNF635, pogo transposable element with ZNF domain, putative protein product of Nbla00003, SUHW5MGC71543, Suppressor of hairy wing homolog 5, Zinc finger protein 280E, Zinc finger protein 635, ZNF280EZNF635m

Gene Symbol

POGZ

Additional POGZ Products

Product Documents for POGZ Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for POGZ Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POGZ Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POGZ Antibody - BSA Free and earn rewards!

Have you used POGZ Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...