POLDIP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88071

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all POLDIP2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human POLDIP2. Peptide sequence: SSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEKTPPSGLH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for POLDIP2 Antibody - BSA Free

Western Blot: POLDIP2 Antibody [NBP2-88071]

Western Blot: POLDIP2 Antibody [NBP2-88071]

Western Blot: POLDIP2 Antibody [NBP2-88071] - WB Suggested Anti-POLDIP2 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal kidney

Applications for POLDIP2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POLDIP2

POLDIP2 encodes a protein that interacts with the DNA polymerase delta p50 subunit. The encoded protein also interacts with proliferating cell nuclear antigen. Some transcripts of this gene overlap in a tail-to-tail orientation with the gene for tumor necrosis factor, alpha-induced protein 1 (TNFAIP1).

Alternate Names

DKFZP586F1524, p38, PDIP38DKFZp586F1524,38 kDa DNA polymerase delta interaction protein, POLD4, polymerase (DNA-directed), delta interacting protein 2, polymerase delta interacting protein 38, polymerase delta-interacting protein 2

Gene Symbol

POLDIP2

Additional POLDIP2 Products

Product Documents for POLDIP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for POLDIP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POLDIP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POLDIP2 Antibody - BSA Free and earn rewards!

Have you used POLDIP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies