POLR2J3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09686

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all POLR2J3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human POLR2J2 (NP_001091084). Peptide sequence APPAFESFLLFEGEKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKD

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for POLR2J3 Antibody - BSA Free

Western Blot: POLR2J3 Antibody [NBP3-09686]

Western Blot: POLR2J3 Antibody [NBP3-09686]

Western Blot: POLR2J3 Antibody [NBP3-09686] - Western blot analysis of POLR2J3 in Fetal Lung lysates. Antibody dilution at 1.0ug/ml

Applications for POLR2J3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POLR2J3

Alternate Names

DNA-Directed RNA Polymerase II Subunit 11, DNA-Directed RNA Polymerase II Subunit J3, DNA-Directed RNA Polymerase II Subunit RPB11-B2, Polymerase (RNA) II (DNA Directed) Polypeptide J3, Polymerase (RNA) II Subunit J3, RNA Polymerase II Subunit B11-B2, RNA Polymerase II Subunit J3, RPB11b1, RPB11b2

Gene Symbol

POLR2J3

Additional POLR2J3 Products

Product Documents for POLR2J3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for POLR2J3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POLR2J3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POLR2J3 Antibody - BSA Free and earn rewards!

Have you used POLR2J3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies