POLR3A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-53051

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to POLR3A(polymerase (RNA) III (DNA directed) polypeptide A, 155 kDa) The peptide sequence was selected from the middle region of POLR3A (NP_008986). Peptide sequence AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to subunit or isoform: RPC1.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

156 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for POLR3A Antibody - BSA Free

Western Blot: POLR3A Antibody [NBP1-53051]

Western Blot: POLR3A Antibody [NBP1-53051]

Western Blot: POLR3A Antibody [NBP1-53051] - Human Muscle lysate. Recommended antibody concentration: 0.2 - 1 ug/mL.

Applications for POLR3A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POLR3A

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3A is the largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition.

Alternate Names

DNA-directed RNA polymerase III largest subunit, DNA-directed RNA polymerase III subunit A, DNA-directed RNA polymerase III subunit RPC1, EC 2.7.7.6, hRPC155, POL3A, polymerase (RNA) III (DNA directed) polypeptide A, 155kDa, RNA polymerase III 155 kDa subunit, RNA polymerase III subunit C160, RNA polymerase III subunit RPC155-D, RPC1, RPC155RNA polymerase III subunit C1

Entrez Gene IDs

11128 (Human); 66368 (Mouse); 540308 (Bovine)

Gene Symbol

POLR3A

UniProt

Additional POLR3A Products

Product Documents for POLR3A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for POLR3A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for POLR3A Antibody - BSA Free

Customer Reviews for POLR3A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POLR3A Antibody - BSA Free and earn rewards!

Have you used POLR3A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...