POLR3B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54363

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all POLR3B Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to POLR3B(polymerase (RNA) III (DNA directed) polypeptide B) The peptide sequence was selected from the C terminal of POLR3B. Peptide sequence IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: RPC2.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

128 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for POLR3B Antibody - BSA Free

Western Blot: POLR3B Antibody [NBP1-54363]

Western Blot: POLR3B Antibody [NBP1-54363]

Western Blot: POLR3B Antibody [NBP1-54363] - Human Heart lysate, concentration 0.2-1 ug/ml.

Applications for POLR3B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POLR3B

POLR3B belongs to the RNA polymerase beta chain family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3B is the second largest core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It is proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol III is composed of mobile elements and RPC2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft.

Alternate Names

C128, DKFZp686B10117, DNA-directed RNA polymerase III 127.6 kDa polypeptide, DNA-directed RNA polymerase III subunit B, DNA-directed RNA polymerase III subunit RPC2, EC 2.7.7.6, FLJ10388, polymerase (RNA) III (DNA directed) polypeptide B, RNA polymerase III subunit C2, RPC2

Gene Symbol

POLR3B

UniProt

Q9NW08 (Human)

Additional POLR3B Products

Product Documents for POLR3B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for POLR3B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POLR3B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POLR3B Antibody - BSA Free and earn rewards!

Have you used POLR3B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies