Poly-Ubiquitin Antibody - M1 Linkage - BSA Free

Novus Biologicals | Catalog # NBP3-05631

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Dot Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human M1-linkage Specific Polyubiquitin (NP_066289.3/NP_061828.1). MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Poly-Ubiquitin Antibody - M1 Linkage - BSA Free

Western Blot: Poly-Ubiquitin AntibodyM1 LinkageAzide and BSA Free [NBP3-05631]

Western Blot: Poly-Ubiquitin AntibodyM1 LinkageAzide and BSA Free [NBP3-05631]

Western Blot: Poly-Ubiquitin Antibody - M1 Linkage [NBP3-05631] - Western blot analysis of extracts of various cell lines, using Poly-Ubiquitin antibody (NBP3-05631) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Poly-Ubiquitin Antibody - M1 Linkage - Azide and BSA Free

Dot Blot: Poly-Ubiquitin Antibody - M1 Linkage - Azide and BSA Free [Poly-Ubiquitin] -

Dot Blot: Poly-Ubiquitin Antibody - M1 Linkage - Azide and BSA Free [Poly-Ubiquitin] - Dot-blot analysis of all sorts of peptides using Poly-Ubiquitin antibody at 1:1000 dilution.

Applications for Poly-Ubiquitin Antibody - M1 Linkage - BSA Free

Application
Recommended Usage

Dot Blot

1:500 - 1:1000

ELISA

Recommended starting concentration is 1 μg/mL.

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Poly-Ubiquitin

Poly-Ubiquitin chains are composed of Ubiquitin monomers that are covalently linked through isopeptide bonds, which typically form between a lysine residue of one Ubiquitin molecule and the C-terminal glycine residue of another Ubiquitin molecule. Each human Ubiquitin monomer is 76 amino acids (aa) in length and shares 96% and 100% aa identity with yeast and mouse Ubiquitin, respectively. Seven of the 76 aa in Ubiquitin are lysine residues that can participate in poly-Ubiquitin chain formation. Linkage through specific lysine residues is thought to serve as a signal that affects protein degradation, signaling, trafficking, and other cellular processes.

Alternate Names

PolyUbiquitin

Gene Symbol

RPS27A

Additional Poly-Ubiquitin Products

Product Documents for Poly-Ubiquitin Antibody - M1 Linkage - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Poly-Ubiquitin Antibody - M1 Linkage - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Related Research Areas

Citations for Poly-Ubiquitin Antibody - M1 Linkage - BSA Free

Customer Reviews for Poly-Ubiquitin Antibody - M1 Linkage - BSA Free

There are currently no reviews for this product. Be the first to review Poly-Ubiquitin Antibody - M1 Linkage - BSA Free and earn rewards!

Have you used Poly-Ubiquitin Antibody - M1 Linkage - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...