Poly-Ubiquitin chains are composed of Ubiquitin monomers that are covalently linked through isopeptide bonds, which typically form between a lysine residue of one Ubiquitin molecule and the C-terminal glycine residue of another Ubiquitin molecule. Each human Ubiquitin monomer is 76 amino acids (aa) in length and shares 96% and 100% aa identity with yeast and mouse Ubiquitin, respectively. Seven of the 76 aa in Ubiquitin are lysine residues that can participate in poly-Ubiquitin chain formation. Linkage through specific lysine residues is thought to serve as a signal that affects protein degradation, signaling, trafficking, and other cellular processes.
Poly-Ubiquitin Antibody - M1 Linkage - BSA Free
Novus Biologicals | Catalog # NBP3-05631
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA, Dot Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human M1-linkage Specific Polyubiquitin (NP_066289.3/NP_061828.1). MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Poly-Ubiquitin Antibody - M1 Linkage - BSA Free
Western Blot: Poly-Ubiquitin AntibodyM1 LinkageAzide and BSA Free [NBP3-05631]
Western Blot: Poly-Ubiquitin Antibody - M1 Linkage [NBP3-05631] - Western blot analysis of extracts of various cell lines, using Poly-Ubiquitin antibody (NBP3-05631) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.Dot Blot: Poly-Ubiquitin Antibody - M1 Linkage - Azide and BSA Free [Poly-Ubiquitin] -
Dot Blot: Poly-Ubiquitin Antibody - M1 Linkage - Azide and BSA Free [Poly-Ubiquitin] - Dot-blot analysis of all sorts of peptides using Poly-Ubiquitin antibody at 1:1000 dilution.Applications for Poly-Ubiquitin Antibody - M1 Linkage - BSA Free
Application
Recommended Usage
Dot Blot
1:500 - 1:1000
ELISA
Recommended starting concentration is 1 μg/mL.
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Poly-Ubiquitin
Alternate Names
PolyUbiquitin
Gene Symbol
RPS27A
Additional Poly-Ubiquitin Products
Product Documents for Poly-Ubiquitin Antibody - M1 Linkage - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Poly-Ubiquitin Antibody - M1 Linkage - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govRelated Research Areas
Citations for Poly-Ubiquitin Antibody - M1 Linkage - BSA Free
Customer Reviews for Poly-Ubiquitin Antibody - M1 Linkage - BSA Free
There are currently no reviews for this product. Be the first to review Poly-Ubiquitin Antibody - M1 Linkage - BSA Free and earn rewards!
Have you used Poly-Ubiquitin Antibody - M1 Linkage - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...