Polypeptide GalNac Transferase 4/GALNT4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69399

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to GALNT4(UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 4 (GalNAc-T4)) The peptide sequence was selected from the C terminal of GALNT4. Peptide sequence ANLSLFGCHGQGGNQFFEYTSNKEIRFNSVTELCAEVPEQKNYVGMQNCP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Polypeptide GalNac Transferase 4/GALNT4 Antibody - BSA Free

Western Blot: Polypeptide GalNac Transferase 4/GALNT4 Antibody [NBP1-69399]

Western Blot: Polypeptide GalNac Transferase 4/GALNT4 Antibody [NBP1-69399]

Western Blot: GALNT4 Antibody [NBP1-69399] - This Anti-GALNT4 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.

Applications for Polypeptide GalNac Transferase 4/GALNT4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Polypeptide GalNAc Transferase 4/GALNT4

GALNT4 catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. It has a highest activity toward Muc7, EA2 and Muc2, with a lowest activity than GALNT2. This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. In vitro, the encoded protein can complement other GalNAc-Ts in the complete O-glycosylation of the mucin-1 tandem repeat and can O-glycosylate the P-selectin glycoprotein ligand-1 molecule. The coding region of this gene is contained within a single exon.

Long Name

UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 4

Alternate Names

GALNACT4

Gene Symbol

GALNT4

UniProt

Additional Polypeptide GalNAc Transferase 4/GALNT4 Products

Product Documents for Polypeptide GalNac Transferase 4/GALNT4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Polypeptide GalNac Transferase 4/GALNT4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Polypeptide GalNac Transferase 4/GALNT4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Polypeptide GalNac Transferase 4/GALNT4 Antibody - BSA Free and earn rewards!

Have you used Polypeptide GalNac Transferase 4/GALNT4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...