POMC Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57719

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SQCQDLTTESNLLECIRACKPDLSAETPMFPGNGDEQPLTENPRKYVMGHFRWDRFG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for POMC Antibody - BSA Free

Immunohistochemistry-Paraffin: POMC Antibody [NBP2-57719]

Immunohistochemistry-Paraffin: POMC Antibody [NBP2-57719]

Immunohistochemistry-Paraffin: POMC Antibody [NBP2-57719] - Staining of human pituitary gland.
Immunohistochemistry-Paraffin: POMC Antibody [NBP2-57719]

Immunohistochemistry-Paraffin: POMC Antibody [NBP2-57719]

Immunohistochemistry-Paraffin: POMC Antibody [NBP2-57719] - Staining of human testis.
Immunohistochemistry-Paraffin: POMC Antibody [NBP2-57719]

Immunohistochemistry-Paraffin: POMC Antibody [NBP2-57719]

Immunohistochemistry-Paraffin: POMC Antibody [NBP2-57719] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: POMC Antibody [NBP2-57719]

Immunohistochemistry-Paraffin: POMC Antibody [NBP2-57719]

Immunohistochemistry-Paraffin: POMC Antibody [NBP2-57719] - Staining of human liver.
Immunohistochemistry-Paraffin: POMC Antibody [NBP2-57719]

Immunohistochemistry-Paraffin: POMC Antibody [NBP2-57719]

Immunohistochemistry-Paraffin: POMC Antibody [NBP2-57719] - Staining of human cerebral cortex, liver, pituitary gland and testis using Anti-POMC antibody NBP2-57719 (A) shows similar protein distribution across tissues to independent antibody NBP2-55008 (B).

Applications for POMC Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:5000 - 1:10000

Immunohistochemistry-Paraffin

1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POMC

POMC encodes a polypeptide hormone precursor that undergoes extensive, tissue-specific, post-translational processing via cleavage by subtilisin-like enzymes known as prohormone convertases. There are eight potential cleavage sites within the polypeptide precursor and, depending on tissue type and the available convertases, processing may yield as many as ten biologically active peptides involved in diverse cellular functions. The encoded protein is synthesized mainly in corticotroph cells of the anterior pituitary where four cleavage sites are used; adrenocorticotrophin, essential for normal steroidogenesis and the maintenance of normal adrenal weight, and lipotropin beta are the major end products. In other tissues, including the hypothalamus, placenta, and epithelium, all cleavage sites may be used, giving rise to peptides with roles in pain and energy homeostasis, melanocyte stimulation, and immune modulation. These include several distinct melanotropins, lipotropins, and endorphins that are contained within the adrenocorticotrophin and beta-lipotropin peptides. Mutations in this gene have been associated with early onset obesity, adrenal insufficiency, and red hair pigmentation. Alternatively spliced transcript variants encoding the same protein have been described.

Long Name

Proopiomelanocortin

Alternate Names

ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, Corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein

Gene Symbol

POMC

Additional POMC Products

Product Documents for POMC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for POMC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POMC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POMC Antibody - BSA Free and earn rewards!

Have you used POMC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...