POU3F3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10964

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all POU3F3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human POU3F3 (NP_006227). Peptide sequence GGGGGGGGGAGGGGGGMQPGSAAVTSGAYRGDPSSVKMVQSDFMQGAMAA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for POU3F3 Antibody - BSA Free

Western Blot: POU3F3 Antibody [NBP3-10964]

Western Blot: POU3F3 Antibody [NBP3-10964]

Western Blot: POU3F3 Antibody [NBP3-10964] - Western blot analysis using NBP3-10964 on Human OVCAR-3 as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for POU3F3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POU3F3

POU3F3, also known as POU Class 3 Homeobox 3, is a transcription factor that is primarily expressed in the brain and CNS. POU3F3 interacts with SOX4 and SOX11, and is implicated in the development of neurons. Current research surrounding POU3F3 has shown potential linkages with neuronitis and cerebritis. POU3F3 has also been shown to interact with POU3F4, CAV1, SOX10, and GADD34.

Alternate Names

Brain-1, Brain-specific homeobox/POU domain protein 1, Brn-1, BRN1brn-1, Oct-8, Octamer-binding protein 8, Octamer-binding transcription factor 8, OTF-8, OTF8oct-8, POU class 3 homeobox 3, POU domain class 3, transcription factor 3, POU domain, class 3, transcription factor 3

Gene Symbol

POU3F3

Additional POU3F3 Products

Product Documents for POU3F3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for POU3F3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POU3F3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POU3F3 Antibody - BSA Free and earn rewards!

Have you used POU3F3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies