POU4F3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82384

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all POU4F3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide towards Pou4f3. Peptide sequence PKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for POU4F3 Antibody - BSA Free

Western Blot: POU4F3 Antibody [NBP1-82384]

Western Blot: POU4F3 Antibody [NBP1-82384]

Western Blot: POU4F3 Antibody [NBP1-82384] - Mouse Heart Lysate 1.0 ug/ml, gel concentration 12%

Applications for POU4F3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POU4F3

The POU4F3 gene encodes a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. This protein is found in the retina and may play a role in determi

Alternate Names

Brain-3C, Brain-specific homeobox/POU domain protein 3C, BRN3.1, Brn-3C, BRN3Cbrn-3C, DFNA15, MGC138412, POU class 4 homeobox 3, POU domain class 4, transcription factor 3, POU domain, class 4, transcription factor 3

Gene Symbol

POU4F3

UniProt

NP_620395 (Mouse)

Additional POU4F3 Products

Product Documents for POU4F3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for POU4F3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POU4F3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POU4F3 Antibody - BSA Free and earn rewards!

Have you used POU4F3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies