PPFIA3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85513

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat PPFIA3. Peptide sequence: ETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PPFIA3 Antibody - BSA Free

Western Blot: PPFIA3 Antibody [NBP2-85513]

Western Blot: PPFIA3 Antibody [NBP2-85513]

Western Blot: PPFIA3 Antibody [NBP2-85513] - Host: Rabbit. Target Name: Ppfia3. Sample Type: Rat Lung lysates. Antibody Dilution: 1.0ug/ml

Applications for PPFIA3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PPFIA3

PPFIA3, also known as Liprin-alpha-3, has a 1,194 amino acid long isoform that is 133kDa and a slightly shorter 1,185 amino acid isoform that is approximately 132kDa. PPFIA3 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. PPFIA3 is localized to the cytoplasm and cell surface, and is highly expressed in the brain. As a member of the Liprin family, research shows that PPFIA3 may play a role in the disassembly of focal adhesions. Current research surrounding PPFIA3 shows that it may be implicated in various diseases and disorders including cerebritis, cerebral malformations, cocaine abuse, neuronitis and epilepsy. PPFIA3 has also been shown to interact with GIT1, PTPRS, PIK3R1, ERC2, and PPFIBP2.

Alternate Names

KIAA0654liprin, liprin-alpha-3, LPNA3liprin-alpha 3, MGC126567, MGC126569, Protein tyrosine phosphatase receptor type f polypeptide-interacting proteinalpha-3, protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interactingprotein (liprin), alpha 3, protein tyrosine phosphatase, receptor type, f polypeptide, alpha 3, PTPRF-interacting protein alpha-3

Gene Symbol

PPFIA3

Additional PPFIA3 Products

Product Documents for PPFIA3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PPFIA3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PPFIA3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PPFIA3 Antibody - BSA Free and earn rewards!

Have you used PPFIA3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...