PPIH Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57630

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PPIH Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PPIH (peptidylprolyl isomerase H (cyclophilin H)) The peptide sequence was selected from the N terminal of PPIH)(50ug). Peptide sequence VVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PPIH Antibody - BSA Free

Western Blot: PPIH Antibody [NBP1-57630]

Western Blot: PPIH Antibody [NBP1-57630]

Western Blot: PPIH Antibody [NBP1-57630] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Applications for PPIH Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PPIH

The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.

Alternate Names

cyclophilin H, CYP20, CypH, CYPHpeptidyl prolyl isomerase H (cyclophilin H), EC 5.2.1.8, MGC5016, peptidyl-prolyl cis-trans isomerase H, peptidylprolyl isomerase H (cyclophilin H), PPIase H, Rotamase H, Small nuclear ribonucleoprotein particle-specific cyclophilin H, SnuCyp-20, USA-CyP SnuCyp-20, USA-CYPCYP-20, U-snRNP-associated cyclophilin SnuCyp-20, U-snRNP-associated cyclophilin SunCyp-20

Gene Symbol

PPIH

UniProt

O43447 (Human)

Additional PPIH Products

Product Documents for PPIH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PPIH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PPIH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PPIH Antibody - BSA Free and earn rewards!

Have you used PPIH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies