PPP2R5B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88958

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PPP2R5B Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PPP2R5B Antibody - BSA Free

Western Blot: PPP2R5B Antibody [NBP1-88958]

Western Blot: PPP2R5B Antibody [NBP1-88958]

Western Blot: PPP2R5B Antibody [NBP1-88958] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4.
Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958]

Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958]

Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958] - Staining of human liver shows no positivity in hepatocytes as expected.
Western Blot: PPP2R5B Antibody [NBP1-88958]

Western Blot: PPP2R5B Antibody [NBP1-88958]

Western Blot: PPP2R5B Antibody [NBP1-88958] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958]

Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958]

Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958] - Staining of human hippocampus shows moderate nuclear positivity in neurons.
Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958]

Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958]

Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958] - Staining of human testis shows weak to moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958]

Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958]

Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958] - Staining of human cerebellum shows moderate to strong nuclear positivity in Purkinje cells.

Applications for PPP2R5B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PPP2R5B

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a beta isoform of the regulatory subunit B56 subfamily.

Alternate Names

B56B, FLJ35411, PP2A B subunit isoform B56-beta, PP2A B subunit isoform B'-beta, PP2A B subunit isoform PR61-beta, PP2A B subunit isoform R5-beta, PR61B, protein phosphatase 2, regulatory subunit B (B56), beta isoform, protein phosphatase 2, regulatory subunit B', beta, protein phosphatase 2, regulatory subunit B', beta isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, betaisoform, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform

Gene Symbol

PPP2R5B

Additional PPP2R5B Products

Product Documents for PPP2R5B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PPP2R5B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PPP2R5B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PPP2R5B Antibody - BSA Free and earn rewards!

Have you used PPP2R5B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies