PRAF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56449

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to POLR1E (polymerase (RNA) I polypeptide E, 53kDa) The peptide sequence was selected from the N terminal of POLR1E)(50ug). Peptide sequence SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: RPA49.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PRAF1 Antibody - BSA Free

Western Blot: PRAF1 Antibody [NBP1-56449]

Western Blot: PRAF1 Antibody [NBP1-56449]

Western Blot: PRAF1 Antibody [NBP1-56449] - Lanes: Lane1: 50 ug mouse heptoma cell lysate Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:5000 Gene Name: PORL1E
Western Blot: PRAF1 Antibody [NBP1-56449]

Western Blot: PRAF1 Antibody [NBP1-56449]

Western Blot: PRAF1 Antibody [NBP1-56449] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Hela cell lysate

Applications for PRAF1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PRAF1

POLR1E is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.POLR1E is the component of RNA polymerase I which synthesizes ribosomal RNA precursors.POLR1E appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF.

Alternate Names

DNA-directed RNA polymerase I subunit E, DNA-directed RNA polymerase I subunit RPA49, FLJ13390, FLJ13970, FLJ43482, PAF53RNA polymerase I-associated factor 1, polymerase (RNA) I associated factor 1, polymerase (RNA) I polypeptide E, 53kDa, PRAF1, RNA polymerase I associated factor 53, RNA polymerase I subunit A49, RNA polymerase I-associated factor 53, RP11-405L18.3

Gene Symbol

POLR1E

Additional PRAF1 Products

Product Documents for PRAF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PRAF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PRAF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PRAF1 Antibody - BSA Free and earn rewards!

Have you used PRAF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...