Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free
Novus Biologicals | Catalog # H00005173-M01
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot, ELISA, Sandwich ELISA, Immunoprecipitation
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # 2E12
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Prodynorphin/PDYN (NP_077722.1, 205 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSGELFDA
Specificity
PDYN - prodynorphin (2E12)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free
Western Blot: Prodynorphin/PDYN Antibody (2E12) [H00005173-M01]
Western Blot: Prodynorphin/PDYN Antibody (2E12) [H00005173-M01] - Analysis of Prodynorphin/PDYN expression in transfected 293T cell line by Prodynorphin/PDYN monoclonal antibody (M01), clone 2E12.Lane 1: Prodynorphin/PDYN transfected lysate(28.4 KDa).Lane 2: Non-transfected lysate.Immunoprecipitation: Prodynorphin/PDYN Antibody (2E12) [H00005173-M01]
Immunoprecipitation: Prodynorphin/PDYN Antibody (2E12) [H00005173-M01] - Analysis of Prodynorphin/PDYN transfected lysate using anti-Prodynorphin/PDYN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with Prodynorphin/PDYN MaxPab rabbit polyclonal antibody.
Sandwich ELISA: Prodynorphin/PDYN Antibody (2E12) [H00005173-M01] - Detection limit for recombinant GST tagged Prodynorphin/PDYN is 0.1 ng/ml as a capture antibody.
Applications for Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Reviewed Applications
Read 1 review rated 5 using H00005173-M01 in the following applications:
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: Prodynorphin/PDYN
Alternate Names
ADCA, Beta-neoendorphin-dynorphin, leu-enkephalin, leumorphin, neoendorphin-dynorphin-enkephalin prepropeptide, PENKB, preprodynorphin, preproenkephalin B, proenkephalin-B, rimorphin, SCA23
Entrez Gene IDs
5173 (Human)
Gene Symbol
PDYN
UniProt
Additional Prodynorphin/PDYN Products
Product Documents for Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free (1)
5 out of 5
1 Customer Rating
Have you used Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: Brain tissue lysateSpecies: HumanVerified Customer | Posted 11/23/2021Brain tissue lysates
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Immunoprecipitation Protocol
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...