Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free

Novus Biologicals | Catalog # H00005173-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2E12

Format

Azide and BSA Free
View all Prodynorphin/PDYN Primary Antibodies »

Product Specifications

Immunogen

Prodynorphin/PDYN (NP_077722.1, 205 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSGELFDA

Specificity

PDYN - prodynorphin (2E12)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free

Western Blot: Prodynorphin/PDYN Antibody (2E12) [H00005173-M01]

Western Blot: Prodynorphin/PDYN Antibody (2E12) [H00005173-M01]

Western Blot: Prodynorphin/PDYN Antibody (2E12) [H00005173-M01] - Analysis of Prodynorphin/PDYN expression in transfected 293T cell line by Prodynorphin/PDYN monoclonal antibody (M01), clone 2E12.Lane 1: Prodynorphin/PDYN transfected lysate(28.4 KDa).Lane 2: Non-transfected lysate.
Immunoprecipitation: Prodynorphin/PDYN Antibody (2E12) [H00005173-M01]

Immunoprecipitation: Prodynorphin/PDYN Antibody (2E12) [H00005173-M01]

Immunoprecipitation: Prodynorphin/PDYN Antibody (2E12) [H00005173-M01] - Analysis of Prodynorphin/PDYN transfected lysate using anti-Prodynorphin/PDYN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with Prodynorphin/PDYN MaxPab rabbit polyclonal antibody.
Sandwich ELISA: Prodynorphin/PDYN Antibody (2E12) [H00005173-M01] - Detection limit for recombinant GST tagged Prodynorphin/PDYN is 0.1 ng/ml as a capture antibody.

Applications for Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Reviewed Applications

Read 1 review rated 5 using H00005173-M01 in the following applications:

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Prodynorphin/PDYN

The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2010]

Alternate Names

ADCA, Beta-neoendorphin-dynorphin, leu-enkephalin, leumorphin, neoendorphin-dynorphin-enkephalin prepropeptide, PENKB, preprodynorphin, preproenkephalin B, proenkephalin-B, rimorphin, SCA23

Entrez Gene IDs

5173 (Human)

Gene Symbol

PDYN

UniProt

NP_077722 (Human)

Additional Prodynorphin/PDYN Products

Product Documents for Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Dynorphin Antibody (2E12)
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Brain tissue lysate
    Species: Human
    Verified Customer | Posted 11/23/2021
    Brain tissue lysates
    Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free H00005173-M01

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies