Profilin 1 Antibody (2Z1M4)

Novus Biologicals | Catalog # NBP3-16780

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2Z1M4 expressed in HEK293
View all Profilin 1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 61-140 of human PFN1 (P07737). VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Profilin 1 Antibody (2Z1M4)

Western Blot: Profilin 1 Antibody (2Z1M4) [NBP3-16780]

Western Blot: Profilin 1 Antibody (2Z1M4) [NBP3-16780]

Western Blot: Profilin 1 Antibody (2Z1M4) [NBP3-16780] - Western blot analysis of extracts of various cell lines, using Profilin 1 Rabbit mAb (NBP3-16780) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Applications for Profilin 1 Antibody (2Z1M4)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Profilin 1

Profilin is an ubiquitous small (12-15 kDa) phosphoinositides and poly-L-proline binding protein that plays a role both in signal transduction pathways and actin filament dynamics. There are two mammalian profilins with similar biochemical properties but different expression patterns. Whereas profilin I appears to be highly expressed in most tissues except for skeletal muscle, profilin II is predominantly expressed in brain and at lower levels. It is also in expressed in skeletal muscle, the uterus and kidneys. Profilin is a mainly cytosolic protein with higher concentrations in dynamic membrane areas like the leading edge and ruffling membranes.

Alternate Names

PFN1, PROF1, Profilin I

Gene Symbol

PFN1

Additional Profilin 1 Products

Product Documents for Profilin 1 Antibody (2Z1M4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Profilin 1 Antibody (2Z1M4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Customer Reviews for Profilin 1 Antibody (2Z1M4)

There are currently no reviews for this product. Be the first to review Profilin 1 Antibody (2Z1M4) and earn rewards!

Have you used Profilin 1 Antibody (2Z1M4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies