Proteasome 20S alpha 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88094

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Proteasome 20S alpha 3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Proteasome 20S alpha 3. Peptide sequence: TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Proteasome 20S alpha 3 Antibody - BSA Free

Western Blot: Proteasome 20S alpha 3 Antibody [NBP2-88094]

Western Blot: Proteasome 20S alpha 3 Antibody [NBP2-88094]

Western Blot: Proteasome 20S alpha 3 Antibody [NBP2-88094] - WB Suggested Anti-PSMA3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 293T cell lysate

Applications for Proteasome 20S alpha 3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Proteasome 20S alpha 3

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified. (provided by RefSeq)

Long Name

Proteasome subunit alpha type-3

Alternate Names

HC8, PSC8, PSMA3

Gene Symbol

PSMA3

Additional Proteasome 20S alpha 3 Products

Product Documents for Proteasome 20S alpha 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Proteasome 20S alpha 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Proteasome 20S alpha 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Proteasome 20S alpha 3 Antibody - BSA Free and earn rewards!

Have you used Proteasome 20S alpha 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies