Protein Kinase A Regulatory Subunit II alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09404

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PKA RII alpha Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Protein Kinase A Regulatory Subunit II alpha (NP_004148). Peptide sequence IESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAAS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Protein Kinase A Regulatory Subunit II alpha Antibody - BSA Free

Western Blot: Protein Kinase A Regulatory Subunit II alpha Antibody [NBP3-09404]

Western Blot: Protein Kinase A Regulatory Subunit II alpha Antibody [NBP3-09404]

Western Blot: Protein Kinase A Regulatory Subunit II alpha Antibody [NBP3-09404] - Western blot analysis of Protein Kinase A Regulatory Subunit II alpha in Human PC-3 Whole Cell lysates. Antibody dilution at 1ug/ml

Applications for Protein Kinase A Regulatory Subunit II alpha Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PKA RII alpha

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. It may interact with various A-kinase anchoring proteins and determine the subcellular localization of cAMP-dependent protein kinase. This subunit has been shown to regulate protein transport from endosomes to the Golgi apparatus and further to the endoplasmic reticulum (ER). [provided by RefSeq, Jul 2008]

Long Name

cAMP-dependent Protein Kinase Regulatory Type II alpha

Alternate Names

PRKAR2A

Gene Symbol

PRKAR2A

Additional PKA RII alpha Products

Product Documents for Protein Kinase A Regulatory Subunit II alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Protein Kinase A Regulatory Subunit II alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Protein Kinase A Regulatory Subunit II alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Protein Kinase A Regulatory Subunit II alpha Antibody - BSA Free and earn rewards!

Have you used Protein Kinase A Regulatory Subunit II alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies