Protein mab-21-like 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55246

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Protein mab-21-like 1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MAB21L1(mab-21-like 1 (C. elegans)) The peptide sequence was selected from the N terminal of MAB21L1. Peptide sequence IAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Protein mab-21-like 1 Antibody - BSA Free

Western Blot: Protein mab-21-like 1 Antibody [NBP1-55246]

Western Blot: Protein mab-21-like 1 Antibody [NBP1-55246]

Western Blot: Protein mab-21-like 1 Antibody [NBP1-55246] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for Protein mab-21-like 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Protein mab-21-like 1

This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders.This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders. There is evidence that this gene has 2 transcripts with alternate polyA sites, but the full length nature of the longer transcript has not been defined. Sequence Note: The sequence U38810.1 is a chimeric mRNA clone. Only the mab-21-like protein 1 region was propagated into this RefSeq record.

Alternate Names

CAGR1mab-21 (C. elegans)-like 1, FLJ10197, mab-21-like 1 (C. elegans), mab-21-like protein 1, protein mab-21-like 1

Gene Symbol

MAB21L1

UniProt

Q13394 (Human)

Additional Protein mab-21-like 1 Products

Product Documents for Protein mab-21-like 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Protein mab-21-like 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Protein mab-21-like 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Protein mab-21-like 1 Antibody - BSA Free and earn rewards!

Have you used Protein mab-21-like 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies