Protein mab-21-like 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56150

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Protein mab-21-like 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Protein mab-21-like 1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Protein mab-21-like 1 Antibody [NBP2-56150]

Immunocytochemistry/ Immunofluorescence: Protein mab-21-like 1 Antibody [NBP2-56150]

Immunocytochemistry/Immunofluorescence: Protein mab-21-like 1 Antibody [NBP2-56150] - Staining of human cell line BJ shows localization to nucleoplasm.

Applications for Protein mab-21-like 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Protein mab-21-like 1

Protein mab-21-like 1, or MAB21L1, consists of a 359 amino acid isoform that is 41 kDa, and is involved in embryonic development, especially with the eye and cerebellum. Current research is being conducted on Protein mab-21-like 1 and its relation to several disease and disorders, including neural tube defect, neuronitis, gastroesophageal reflux disease, neuroblastoma, and bipolar affective disorder. The protein has been linked to the positive regulation of cell proliferation and anatomical structure morphogenesis, as well as eye and embryonic organ development. Protein mab-21-like 1 has been found to interact with INSR and SIRT3.

Alternate Names

CAGR1mab-21 (C. elegans)-like 1, FLJ10197, mab-21-like 1 (C. elegans), mab-21-like protein 1, protein mab-21-like 1

Gene Symbol

MAB21L1

Additional Protein mab-21-like 1 Products

Product Documents for Protein mab-21-like 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Protein mab-21-like 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Protein mab-21-like 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Protein mab-21-like 1 Antibody - BSA Free and earn rewards!

Have you used Protein mab-21-like 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies