Prothrombin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58268

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Prothrombin Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to F2(coagulation factor II (thrombin)) The peptide sequence was selected from the middle region of F2 (NP_000497). Peptide sequence ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30846818).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Prothrombin Antibody - BSA Free

Western Blot: Prothrombin Antibody [NBP1-58268]

Western Blot: Prothrombin Antibody [NBP1-58268]

721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268]

Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268]

Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268]

Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268]

Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268]

Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268]

Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue, 5.0ug/ml.

Applications for Prothrombin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

5 ug/ml

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 5 using NBP1-58268 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Prothrombin

Coagulation factor II is proteolytically cleaved to form thrombin in the first step of the coagulation cascade which ultimately results in the stemming of blood loss. F2 also plays a role in maintaining vascular integrity during development and postnatal life.Coagulation factor II is proteolytically cleaved to form thrombin in the first step of the coagulation cascade which ultimately results in the stemming of blood loss. F2 also plays a role in maintaining vascular integrity during development and postnatal life. Mutations in F2 leads to various forms of thrombosis and dysprothrombinemia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

Coagulation factor II, coagulation factor II (thrombin), EC 3.4.21, EC 3.4.21.5, prothrombin, prothrombin B-chain, PT, serine protease

Entrez Gene IDs

2147 (Human)

Gene Symbol

F2

UniProt

P00734

Additional Prothrombin Products

Product Documents for Prothrombin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Prothrombin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Prothrombin Antibody - BSA Free

Customer Reviews for Prothrombin Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Prothrombin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Coagulation Factor II/Thrombin Antibody
    Name: Claudia Klein
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Placental tissue
    Species: Equine
    Verified Customer | Posted 07/14/2017
    Heat mediated antigen retrieval (sodium-citrate based buffer) for 10 min.
    Prothrombin Antibody - BSA Free NBP1-58268

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies