PrPC Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92285

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a Recombinant PrPc protein corresponding to amino acids: SDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PrPC Antibody - BSA Free

Immunohistochemistry-Paraffin: PrPC Antibody [NBP1-92285]

Immunohistochemistry-Paraffin: PrPC Antibody [NBP1-92285]

Immunohistochemistry-Paraffin: PrPC Antibody [NBP1-92285] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding PrPC (PRNP) RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PrPC Antibody [NBP1-92285]

Immunohistochemistry-Paraffin: PrPC Antibody [NBP1-92285]

Immunohistochemistry-Paraffin: PrPC Antibody [NBP1-92285] - Staining of human skin shows weak to moderate cytoplasmic positivity in keratinocytes.
PrPC Antibody - BSA Free Immunohistochemistry: PrPC Antibody - BSA Free [NBP1-92285]

Immunohistochemistry: PrPC Antibody - BSA Free [NBP1-92285]

Analysis in human cerebral cortex and skeletal muscle tissues using NBP1-92285 antibody. Corresponding PRNP RNA-seq data are presented for the same tissues.
PrPC Antibody - BSA Free Immunohistochemistry: PrPC Antibody - BSA Free [NBP1-92285]

Immunohistochemistry: PrPC Antibody - BSA Free [NBP1-92285]

Staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.
PrPC Antibody - BSA Free Immunohistochemistry: PrPC Antibody - BSA Free [NBP1-92285]

Immunohistochemistry: PrPC Antibody - BSA Free [NBP1-92285]

Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.
PrPC Antibody - BSA Free Immunohistochemistry: PrPC Antibody - BSA Free [NBP1-92285]

Immunohistochemistry: PrPC Antibody - BSA Free [NBP1-92285]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
PrPC Antibody - BSA Free Immunohistochemistry: PrPC Antibody - BSA Free [NBP1-92285]

Immunohistochemistry: PrPC Antibody - BSA Free [NBP1-92285]

Staining of human skin shows weak to moderate cytoplasmic positivity in keratinocytes.

Applications for PrPC Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PrPC

Prion diseases are transmissible neurodegenerative disorders which affect a range of mammalian species. In humans they can be inherited and sporadic as well as acquired by exposure to human prions. Prions appear to be composed principally of a conformational isomer of host-encoded prion protein and propagate by recruitment of cellular prion protein (1). The function of the cellular prion protein (PrP) is still poorly understood. It has been proposed that one unprecedented role for PrP is against Bax-mediated neuronal apoptosis. It has been shown that PrP potently inhibits Bax-induced cell death in human primary neurons (2). An impaired synaptic inhibition may be involved in the epileptiform activity seen in Creutzfeldt-Jakob and other neurodegenerative diseases and it is believed that loss of function of PrP may contribute to the early synaptic loss and neuronal degeneration seen in these diseases (3).

Alternate Names

CD230, CJD, fatal familial insomnia), GSS, prion protein, prion protein (p27-30), prion protein PrP, prion-related protein, PRIPMGC26679

Gene Symbol

PRNP

Additional PrPC Products

Product Documents for PrPC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PrPC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PrPC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PrPC Antibody - BSA Free and earn rewards!

Have you used PrPC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...