PRRX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-68808

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Rat

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Validated:

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PRRX1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLHE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PRRX1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PRRX1 Antibody [NBP2-68808]

Immunocytochemistry/ Immunofluorescence: PRRX1 Antibody [NBP2-68808]

Immunocytochemistry/Immunofluorescence: PRRX1 Antibody [NBP2-68808] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
PRRX1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: PRRX1 Antibody - BSA Free [NBP2-68808]

Chromatin Immunoprecipitation-exo-Seq: PRRX1 Antibody - BSA Free [NBP2-68808]

ChIP-Exo-Seq composite graph for Anti-PRRX1 (NBP2-68808) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for PRRX1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PRRX1

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns.

Alternate Names

Homeobox protein PHOX1, paired mesoderm homeo box 1, paired mesoderm homeobox 1 isoform pmx-1b, paired mesoderm homeobox protein 1, paired related homeobox 1, Paired-related homeobox protein 1, PHOX1PRX-1, PMX1PRX1

Gene Symbol

PRRX1

Additional PRRX1 Products

Product Documents for PRRX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PRRX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PRRX1 Antibody - BSA Free

Customer Reviews for PRRX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PRRX1 Antibody - BSA Free and earn rewards!

Have you used PRRX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies