PRRX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10410

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_033142). Peptide sequence DPPAPGPGPPPAPGDCAQARKNFSVSHLLDLEEVAAAGRRAAGPVSGPAE

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PRRX2 Antibody - BSA Free

Western Blot: PRRX2 Antibody [NBP3-10410]

Western Blot: PRRX2 Antibody [NBP3-10410]

Western Blot: PRRX2 Antibody [NBP3-10410] - Western blot analysis of PRRX2 in Mouse Spleen as a positive control. Antibody dilution at 0.2-1 ug/ml

Applications for PRRX2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PRRX2

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation.

Alternate Names

paired related homeobox 2, paired-like homeodomain protein PRX2, Paired-related homeobox protein 2, PMX2paired mesoderm homeobox protein 2, PRX-2, PRX2MGC19843

Gene Symbol

PRRX2

Additional PRRX2 Products

Product Documents for PRRX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PRRX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PRRX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PRRX2 Antibody - BSA Free and earn rewards!

Have you used PRRX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...