PSG1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82316

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PSG1. Peptide sequence: FTYYRSGEVLYLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PSG1 Antibody - BSA Free

Western Blot: PSG1 Antibody [NBP2-82316]

Western Blot: PSG1 Antibody [NBP2-82316]

Western Blot: PSG1 Antibody [NBP2-82316] - Host: Rabbit. Target Name: PSG1. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for PSG1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSG1

PSG1, also known as Pregnancy-specific beta-1-glycoprotein 1, is a 106 amino acid protein that is 12 kDa, secreteded in high quantity during pregnancy, member of the immunoglobulin (Ig) superfamily. Current research is being performed on several diseases and disorders including factor vii deficiency, gestational trophoblastic neoplasm, trophoblastic neoplasm, pre-eclampsia, spontaneous abortion, transitional cell carcinoma, germinoma, down syndrome, basal cell carcinoma, eclampsia, choriocarcinoma, lung carcinoma, carcinoma, esophageal carcinoma, esophagitis, infertility, lung cancer, and alcoholism. This protein has shown an interaction with UTP14A in pregnancy processes.

Long Name

Pregnancy-specific beta-1-glycoprotein 1

Alternate Names

B1G1, CD66f, DHFRP2, PBG1, PS-beta-G-1, PSbG1, PSG-1, PSG95, PSGGA

Gene Symbol

PSG1

Additional PSG1 Products

Product Documents for PSG1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSG1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for PSG1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSG1 Antibody - BSA Free and earn rewards!

Have you used PSG1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...