PSG9 Antibody [Alexa Fluor™ Plus 594]

Novus Biologicals | Catalog # NBP1-57676AFP594

Novus Biologicals

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Alexa Fluor Plus 594 (Excitation = 590 nm, Emission = 618 nm)

Antibody Source

Polyclonal Rabbit IgG
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PSG9(pregnancy specific beta-1-glycoprotein 9) The peptide sequence was selected from the N terminal of PSG9. Peptide sequence YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.

For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.

Applications for PSG9 Antibody [Alexa Fluor™ Plus 594]

Application
Recommended Usage

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Recommended applications are based on validated applications from the unconjugated base product NBP1-57676. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: PSG9

The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390).(supplied by OMIM)

Alternate Names

pregnancy specific beta-1-glycoprotein 9, Pregnancy-specific beta-1 glycoprotein B, Pregnancy-specific beta-1-glycoprotein 11, pregnancy-specific beta-1-glycoprotein 9, Pregnancy-specific glycoprotein 11, Pregnancy-specific glycoprotein 7, Pregnancy-specific glycoprotein 9, PS34, PS-beta-B, PS-beta-G-11, PS-beta-G-9, PSBG-11, PSBG-9, PSG11pregnancy specific beta-1-glycoprotein 11, PSG7, PSGII

Gene Symbol

PSG9

Additional PSG9 Products

Product Documents for PSG9 Antibody [Alexa Fluor™ Plus 594]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSG9 Antibody [Alexa Fluor™ Plus 594]



This product is provided under an intellectual property license from Life Technologies Corporation. The transfer of this product is conditioned on the buyer using the purchased product solely in research conducted by the buyer, excluding contract research or any fee for service research, and the buyer must not (1) use this product or its components for (a) diagnostic, therapeutic or prophylactic purposes; (b) testing, analysis or screening services, or information in return for compensation on a per-test basis; or (c) manufacturing or quality assurance or quality control, and/or (2) sell or transfer this product or its components for resale, whether or not resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5781 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@thermofisher.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PSG9 Antibody [Alexa Fluor™ Plus 594]

There are currently no reviews for this product. Be the first to review PSG9 Antibody [Alexa Fluor™ Plus 594] and earn rewards!

Have you used PSG9 Antibody [Alexa Fluor™ Plus 594]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...