PSMB10/MECL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58937

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PSMB10(proteasome (prosome, macropain) subunit, beta type, 10) The peptide sequence was selected from the middle region of PSMB10. Peptide sequence DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: beta type-10.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PSMB10/MECL1 Antibody - BSA Free

Western Blot: PSMB10/MECL1 Antibody [NBP1-58937]

Western Blot: PSMB10/MECL1 Antibody [NBP1-58937]

Western Blot: PSMB10 Antibody [NBP1-58937] - Human Placenta lysate, concentration 0.2-1 ug/ml.
PSMB10/MECL1 Antibody - BSA Free

Western Blot: PSMB10/MECL1 Antibody - BSA Free [NBP1-58937] -

Effects of M3258 and IFN gamma on the expression of IP and constitutive proteasome subunits in TNBC/IBC cells. (A) Western blot analysis of the basal expression levels of LMP7 in TNBC/IBC cell lines. Cells were cultured for 48 h at 37 C before proteins were extracted and analyzed. (B) Western blot analysis of the effects of M3258 on the expression of IP and constitutive proteasome subunits in TNBC/IBC cells. After overnight incubation in the presence or absence of recombinant human IFN gamma (100 IU/mL), the cells were treated with M3258 at the indicated concentrations for 48 h at 37 C. Proteins were then extracted and analyzed. beta -actin levels in the protein extracts were assessed to control for equivalent protein loading in each gel lane. Original western blots are presented in File S1. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40507366), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for PSMB10/MECL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSMB10/MECL1

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

Long Name

Proteasome (Prosome, Macropain) Subunit, beta Type, 10

Alternate Names

LMP10, MECl-1, MECL1, Proteasome subunit beta-2i

Gene Symbol

PSMB10

UniProt

Additional PSMB10/MECL1 Products

Product Documents for PSMB10/MECL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSMB10/MECL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for PSMB10/MECL1 Antibody - BSA Free

Customer Reviews for PSMB10/MECL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSMB10/MECL1 Antibody - BSA Free and earn rewards!

Have you used PSMB10/MECL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...