PTCRA Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09949

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PTCRA Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTCRA. Peptide sequence TSSPRPQPRDRRWGDTPPGRKPGSPVWGEGSYLSSYPTCPAQAWCSRSAL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PTCRA Antibody - BSA Free

Western Blot: PTCRA Antibody [NBP3-09949]

Western Blot: PTCRA Antibody [NBP3-09949]

Western Blot: PTCRA Antibody [NBP3-09949] - Western blot analysis of PTCRA in HT1080 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for PTCRA Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTCRA

In immature T cells the T-cell receptor beta-chain gene (TCRB; MIM 186930) is rearranged and expressed before the TCRA(MIM 186880) chain. At this early stage, TCRB can associate with the pre-T-cell receptor alpha chain (PTCRA). ThePTCRA, together with TCRB and the CD3 complex (see MIM 186740), minimally make up the pre-T cell receptor (pre-TCR),which regulates early T cell development.(supplied by OMIM)

Alternate Names

pre T-cell antigen receptor alpha, PTA, PT-ALPHA

Gene Symbol

PTCRA

Additional PTCRA Products

Product Documents for PTCRA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PTCRA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PTCRA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PTCRA Antibody - BSA Free and earn rewards!

Have you used PTCRA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies